Frag'R'Us

Parameters

Input pdb2uzi_R.pdb
ChainR
DSSP alphabet3
Secondary structure assignment0   [0: Automatic (DSSP) - 1: User defined]
Minimum helix size5
Mininum beta size2
Scanned DB40
Maximum variation in D (Ang)1.5
Maximum variation in delta (degrees)15
Maximum variation in theta (degrees)15
Maximum variation in rho (degrees)30
Clashes filter active1   [0: off - 1:on]
Tolerance fitting Smotifs (Ang)1.5
Performed task3   [help]

Protein Sequence

1MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTA
60GQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKC
119DLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH

Smotifs

From residue 3 to 25 type EH
jmol
SSEEEEEEEEECCCCCHHHHHHHHHH
Distance7.956150Delta103.674502
Theta144.845974Rho69.693705
Geometrically equivalent Smotifs
PDBChainStartEndTypeDDeltaThetaRho
2zpaA178200EH8.345882104.452208142.93949664.502594jmol
SeqGVAAVTAARGRGKSALAGQLISR
SSEEEEEEEECCCCCHHHHHHHHHHH
2dr3A2347EH8.99438599.322769151.17808274.342919jmol
SeqVVLLSGGPGTGKTIFSQQFLWNGLK
SSEEEEEEECCCCCHHHHHHHHHHHHHH
1cr1A3761EH7.99893699.405762146.37044467.006161jmol
SeqVIMVTSGSGMGKSTFVRQQALQWGT
SSEEEEEEECCCCCHHHHHHHHHHHHHH
3mwbA191214EH7.324961100.577630140.88403071.958343jmol
SeqDKTTVVVPLPEDHPGALEILDQFA
SSEEEEEEEEECCCCCCCCCCHHHHHH
2uz1A94124EH8.357677101.025646147.41459893.154466jmol
SeqVLFLTGSGALRDDETNTLQAGIDQVAMAAPI
SSEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHH
2f6rA3254EH8.65915899.963799154.14378751.807547jmol
SeqYVLGLTGISGSGKSSVAQRLKNL
SSEEEEEEEECCCCCHHHHHHHHHHH
3mg9A832EH9.350616102.671074155.95869370.879646jmol
SeqGIRWIASYPKAGNTWVRCMLAAYIT
SSEEEEEEEECCCCCHHHHHHHHHHHHH
3q72A422EH8.428676104.990962146.73668257.822667jmol
SeqKVLLLGAPGVGKSALARIF
SSEEEEEEECCCCCHHHHHHHH
3louA326EH7.519591112.048226139.79643746.632136jmol
SeqQFVLTLSCPSAAGQVAAVVGLLDR
SSEEEEEEEEEECCCCHHHHHHHHHHH
3czqA7592EH8.605273115.382770154.37966451.457141jmol
SeqVFEGRDAAGKGGAIHATT
SSEEEEECCCCCHHHHHHHHH
3hoiA112151EH8.707146106.770452155.91095548.943730jmol
SeqVSLVLVSDLSKLGDAKSNHVQLGADAGIVSQNISLFCSAA
SSEEEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
3lmaA7595EH7.647677118.171811148.76013553.085211jmol
SeqIFLAGDLLNQNVTANYVARHL
SSEEEEEEECCCCCCCHHHHHHHH
1hbnC10661092EH8.430584103.720633139.36828438.934794jmol
SeqVRYIQFTDSMYFAPAQPYVRSRAYLCR
SSEEEEEEEEECCCCCCCCHHHHHHHHHHH
4jjaA2142EH9.053090103.284689153.71752298.188225
SeqRIAIFSNHTGVGNKHLLDILLE
SSEEEEEECCCCCCCCCCHHHHHHH
3vayA175191EH7.912457106.804464158.13416860.309947
SeqAVHVGDHPSDDIAGAQQ
SSEEEEEECCCCCCHHHHHH
4eogA2338EH6.846174108.626119156.13305885.293201
SeqIKVKSRNTLPILVKTL
SSEEEEEECCCHHHHHHHH
3ga2A110132EH6.74548697.263061144.22037764.745797
SeqFLFDGNGYLHYNHGVATHAAFFL
SSEEEEEECCCCCCCCCHHHHHHHHH
2om6A172188EH7.458183105.671412155.61023275.228771
SeqSLHIGDTYAEDYQGARK
SSEEEEEECCCCCCHHHHHH
4bgpA67104EH8.12640394.668011146.31960885.407266
SeqVINNHFPGNRNNPIGNNDLTIHRLSGYLARWVLDQYNE
SSEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
2xwpA168189EH6.771115100.649829150.400899100.295879
SeqARVGAVESYPEVDILIDSLRDE
SSEEEEEECCCCCCHHHHHHHHHHH
4e4rA121140EH9.45490997.499531144.77175948.838468
SeqGLVSGAAHSTGDTVRPALQI
SSEEEEECCCCCCCCCHHHHHHH
From residue 16 to 46 type HE
jmol
SSEHHHHHHHHHHCCCCCCCCCCCEEEEEEEEEE
Distance17.601964Delta141.018718
Theta32.515799Rho319.754647
Geometrically equivalent Smotifs
PDBChainStartEndTypeDDeltaThetaRho
2ixsA210234HE18.059492134.15571945.792176342.223559
SeqKRIFEETLGLTFDPHGRMPDLVLHD
SSEHHHHHHCCCCCCCCCCCCCCEEEEE
2vh4A135178HE18.312905135.43186935.383967304.346600
SeqSSTVSDINNWVKSKTNGMIDKILNKIDPEDVMYLINAVAFDAEW
SSEHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEEEEEEEEEEE
From residue 37 to 58 type EE
jmol
SSEEEEEEEEEEECCEEEEEEEEEE
Distance6.027624Delta74.632504
Theta143.984862Rho285.778785
Geometrically equivalent Smotifs
PDBChainStartEndTypeDDeltaThetaRho
3tc8A4873EE5.64925088.926264140.650281278.874543jmol
SeqKVYQQEAILTAYDGTKLEARNIIGSF
SSEEEEEEEEEEECCCCCEEEEEEEEEEE
3nokA2337EE4.90661583.871547146.966058315.732250jmol
SeqTQGLVFHQGHFFEST
SSEEEEEEEECCEEEEEE
2vpzA928EE5.38356689.368895133.078958303.565533jmol
SeqKSVYQICEGCFWRCGIVAHA
SSEEEEEEECCCCCCCCEEEEEE
1pz7A6479EE5.38904285.693330137.044620307.320358jmol
SeqYIALAIVDGFVQMMYD
SSEEEEEEEECCEEEEEEE
3h6rA96111EE6.03193687.123768135.026180314.096314jmol
SeqYILQLVPSTADVYIIR
SSEEEEEECCCCCCEEEEE
3phzA4459EE6.33776288.495364136.939578310.204105jmol
SeqWLIEPVGEADTYTVRN
SSEEEEEECCCCCEEEEEE
3g2fA1937EE5.15094082.480447137.718761272.687080jmol
SeqGAVYKGSLDERPVAVKVFS
SSEEEEEEEEECCEEEEEEEEE
1w6gA439468EE7.20878089.607545140.086123280.678811jmol
SeqNRVEEEDVVRQTMGPGNERGNAFSRKRTVL
SSEEEEEEEEEEECCCCCCCCCCCCEEEEEEEE
3n9xA3049EE4.91104580.259436144.048460291.896249jmol
SeqGYVYLAYDKNTEKNVAIKKV
SSEEEEEEEEECCCCEEEEEEEE
3ke7A81107EE5.14154083.174070156.160324294.600178jmol
SeqIAVLTFNLDSYLSDKVIKWNCTEVYRR
SSEEEEEEEEEEEEECCEEEEEEEEEEEEE
3n9xA1837EE5.08070769.248347140.509506282.283262jmol
SeqYIIKHLIGRGSYGYVYLAYD
SSEEEEEEEEEEECCEEEEEEEE
3fssA226EE5.87990867.079063148.475973296.589860jmol
SeqNTIFKLEGVSVLSPLRKKLDLVFYL
SSEEEEEEEEEEEECCCCCEEEEEEEEE
4dzhA332EE7.14874261.944833148.669479293.387144jmol
SeqEPCDLLIEAGYVVPIEPHAVVLEDHAVAVS
SSEEEEEEEEEEEEECCCCCCCCCEEEEEEEEE
3w5jA3955EE5.92092787.151348139.430986297.887275jmol
SeqLLSGKILLGADMVEIID
SSEEEEEEEEECCEEEEEEE
1oo0A324EE6.46823189.511161156.088025312.347379jmol
SeqFYLRYYVGHKGKFGHEFLEFEF
SSEEEEEEEEEEEECCEEEEEEEEE
2cntA121145EE5.10147687.667476146.994635266.322853jmol
SeqNEATIRRNYYPTAQGHEDAIIMALP
SSEEEEEEEEEEEEECCEEEEEEEEEEE
4gs3A6288EE6.50000582.344610144.912001269.785504jmol
SeqRVKIEGQLRSYNRKLILTVFARDISVV
SSEEEEEEEEEEEEECCEEEEEEEEEEEEE
1wuiL717737EE4.82727580.029303151.326140311.235161jmol
SeqAEGVGFVNAPRGGLSHWIRIE
SSEEEEEEEEEECCEEEEEEEEEE
3kewA207225EE5.56395188.836300139.090203294.053369jmol
SeqIKIRRWEKHKNATRIEYVA
SSEEEEEEEEEECCEEEEEEEE
1wakA2847EE4.98432179.562330142.958871292.456224jmol
SeqSTVWLSWDIQGKKFVAMKVV
SSEEEEEEEEECCCCEEEEEEEE
3mnmA86103EE6.19422587.481571144.065488306.789735jmol
SeqKWKVNYSVNSTQAEETAV
SSEEEEEEEEECCEEEEEEEE
3g2fA6483EE5.88607288.051643146.104032307.714553jmol
SeqFIVGDERVTADGRMEYLLVM
SSEEEEEEEEECCCCCEEEEEEE
3i45A339359EE6.48808289.163533133.402863271.320135jmol
SeqAWVGRTALRDGKGVMVDWRYV
SSEEEEEEEEEECCEEEEEEEEEE
3mwdB467482EE4.55350889.445699140.907126290.221407jmol
SeqHKQKFYWGHKEILIPV
SSEEEEEEEECCEEEEEEE
3errA353391EE5.30157165.497493144.033186287.973842jmol
SeqLRYAGYAPAFRSEAGSFGKDVRGLMRVHQFHKVEQYVLT
SSEEEEEEEEEEECCCCCCCCCCCCCCCCCCEEEEEEEEEEE
1qwyA149169EE6.70949477.289952143.760277304.239714jmol
SeqGTVVQAGWSNYGGGNQVTIKE
SSEEEEEEEEEECCCCEEEEEEEE
3nvqA363386EE5.34884689.522697147.125411290.872605jmol
SeqYQKVAVHRMQASHGETFHVLYLTT
SSEEEEEEEEEEECCCCCEEEEEEEEE
2qu8A4056EE4.68461687.023999147.100456299.994080jmol
SeqLYVGHFDHKLNKYQIID
SSEEEEEEEEECCEEEEEEE
3vthA3753EE6.89011686.497092146.814321316.045850jmol
SeqKGIVYNNSSGLYIEVEG
SSEEEEEEEECCEEEEEEEE
1dl5A165191EE7.33473683.144385152.027758310.818899jmol
SeqLKEGGRVIVPINLKLSRRQPAFLFKKK
SSEEEEEEEEEEEECCCCCCCCEEEEEEEE
1jmxB699722EE4.94055988.697075147.681122277.112119jmol
SeqEFSMLYTIARFATADLLYGYLSVD
SSEEEEEEEEEEECCCCEEEEEEEEEE
3cwwA574592EE5.69641186.519308145.286310309.043026jmol
SeqLSYDLQNTIYGMYLSVKGY
SSEEEEEEEEECCEEEEEEEEE
4dwdA325EE5.08095681.862376154.404754305.007525jmol
SeqKIAKVEALSVAGDPTSAFVRITA
SSEEEEEEEEEEECCCCCEEEEEEEE
1deuA213232EE6.18645288.400320150.253835268.557856jmol
SeqHVVSVAGWGISDGTEYWIVR
SSEEEEEEEEEEEECCEEEEEEE
3gknA108121EE4.72522681.417058135.341244303.326517jmol
SeqIKEKNMYGKQVLGI
SSEEEEEEECCEEEEEE
1v6pA2441EE4.95209487.814150144.009003301.168064jmol
SeqCYKKRWRDHRGYRTERGC
SSEEEEEEEEECCEEEEEEEE
12asA192237EE5.24925676.039632144.207137313.656501jmol
SeqAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWN
SSEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEE
2ia7A81104EE5.56651887.403627147.979900291.502753jmol
SeqRLLIDIEYRVRSTNTRFNLVYPFY
SSEEEEEEEEEEECCCCEEEEEEEEEE
3tegA124154EE5.90606377.924017137.235739286.900118jmol
SeqAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLF
SSEEEEEEEEEECCCCCCCCCCCEEEEEEEEEEE
3azoA3453EE4.77923285.974503146.879061298.188136jmol
SeqEVWWVAPRPAEAGRATLVRR
SSEEEEEEEEECCCCCEEEEEEE
3f2bA6995EE7.32502282.057110136.259079277.984031jmol
SeqWVKVRGSVQNDTFVRDLVIIANDLNEI
SSEEEEEEEEEEEECCCCEEEEEEEEEEEE
4gklA382399EE5.27282884.842499143.754255310.534294jmol
SeqICIHSKNVFNDDIVRVSV
SSEEEEEEEECCCCEEEEEEE
3d2fA98113EE6.10110586.994179138.127682296.410096jmol
SeqKTGAEVRFAGEKHVFS
SSEEEEEEEEECCEEEEEE
3k59A2037EE6.17793786.634178150.521099298.682602jmol
SeqGTEVSFWLATDNGPLQVT
SSEEEEEEEEEEECCEEEEEE
4illA205238EE6.87518380.951677152.569043271.254389jmol
SeqRIIGYDLHPVTVAIGESKGNLRKARGVMGWIEFD
SSEEEEEEEEEEEEEEECCCCCCCEEEEEEEEEEEEE
3c2uA419441EE5.22426975.612418145.379652280.787429jmol
SeqNWSSIHVTWNEEKGRIIDLVTAD
SSEEEEEEEEEEECCCEEEEEEEEEE
2cy2A145165EE5.82836285.207312147.232941279.942093jmol
SeqVLLGEREIELGGAKLWEVAYG
SSEEEEEEEEEEECCEEEEEEEEE
1k07A153171EE5.19227284.169082146.958040301.745496jmol
SeqTTWTMKLKDHGKQYQAVII
SSEEEEEEEEEECCEEEEEEEE
1j3mA7691EE5.80326783.856208141.903293300.489502jmol
SeqCNVVLREAEEGVEVLI
SSEEEEEEEEECCEEEEEE
3c6aA5070EE5.17352188.921079140.316216302.628990jmol
SeqHALQIIDITEFPYKQVAVYHS
SSEEEEEEEECCCCCEEEEEEEEE
3v97A357376EE5.04692879.505898144.235794292.670113jmol
SeqADKQYKAKNGPLDCVQKNYH
SSEEEEEEEEEECCEEEEEEEEE
1jb7B575612EE6.20018577.136655148.735933276.199151jmol
SeqVIVINNWSLELRRVNSAEVFTSYANLEARLIVHSFKPN
SSEEEEEEEEEEEEEECCCCCCCCCCCCEEEEEEEEEEEEE
4h2gA136152EE4.88323788.908460142.358579314.258133jmol
SeqYKVLPVGDEVVGIVGYT
SSEEEEEEECCEEEEEEEEE
3s1sA4160EE5.06131378.364621142.488967300.000036jmol
SeqYEVVHHELVGSIEADFVIKN
SSEEEEEEEEEECCEEEEEEEEE
4ed9A238251EE4.55256789.183112143.482164315.244689jmol
SeqYQTLSVSDGYFIIA
SSEEEEEEECCEEEEEE
3bcyA103128EE7.15348176.920963146.663441285.933444jmol
SeqKITWHYGEETEYHGRPFKIDVQVVCT
SSEEEEEEEEEEEEECCEEEEEEEEEEEE
2olrA113134EE4.83758588.749584150.710063312.227057jmol
SeqLFVVDAFCGANPDTRLSVRFIT
SSEEEEEEEEECCCCCCCEEEEEEE
1tu1A7295EE5.66281765.479786143.830168307.482008jmol
SeqKLHKRWDINIHGHAAVLLDYQWQR
SSEEEEEEEEEEECCEEEEEEEEEEEE
1rifA316EE4.88762782.645138144.801851315.555808jmol
SeqIKVHFHDFSHVRID
SSEEEEEEECCCEEEEE
2e4mC630646EE6.11099571.314276155.349713301.714766
SeqEPNKYLAYNDYGFIYLS
SSEEEEEEEEECCCCEEEEE
3nokA113126EE6.23498183.783261146.138144315.475435
SeqKLVRSDGGTMLTFH
SSEEEEEECCCCEEEEE
4dguA92110EE7.42748688.980384156.945069301.545602
SeqLFGTAEAAPGSQNVSLKFK
SSEEEEEEEECCCCCEEEEEEE
3loyA131159EE6.91862687.160087150.006353289.566905
SeqVRVVCDPWMNGTDSKEDRMLIQCYMYLAS
SSEEEEEEEEEECCCCCCCCCCEEEEEEEEEE
2pbiB605623EE6.99373380.567560150.176637308.219500
SeqVLCLDLAPSETGNTFVSGG
SSEEEEEEECCCCCCCEEEEEE
1j7xA240255EE6.40438471.459231148.117090313.556220
SeqSKVFPFGDTQLSVTVP
SSEEEEEECCCCCEEEEEE
2yfoA103138EE6.46067067.038490153.199426306.072781
SeqLFKSYEIRNGKYRLQGLPAVWADEKEAQTLEIVLAD
SSEEEEEEEEEECCCCCCCCCCCCCCCCCEEEEEEEEEE
3phzA1834EE5.19344065.119300150.369720309.948766
SeqTRLALSENKSPDVIISS
SSEEEEEECCCCCCEEEEEE
3keyA152170EE7.12961181.028153153.360932305.215142
SeqLKNWWIDLDNSGILLHLEY
SSEEEEEEEEECCCEEEEEEEE
1qksA496514EE4.56386674.800168148.480616316.017726
SeqRVVQGEFNKDGTEVWFSVW
SSEEEEEEEECCCCCEEEEEEE
4gq1A317333EE6.50648081.406394156.195865312.452272
SeqIVDFCWHQDGSHLAIAT
SSEEEEEEECCCCCEEEEEE
2hdvA3453EE7.38411972.451937147.140439312.720819
SeqVFLVRQSETRRGECVLTFNF
SSEEEEEEECCCCCCEEEEEEEE
3ffvA131147EE5.79247782.739525145.991839313.504658
SeqTLFIATLEEELEVISVC
SSEEEEEEECCCCCEEEEEE
4dzaA300316EE7.52181862.554322133.172392315.277085
SeqQRVPVLGKTSMNTVIVD
SSEEEEEECCCCCCCCEEEE
3pe7A124145EE6.31880887.691682145.960831308.889612
SeqWVGYGTWVANSDCTKLVGIEIR
SSEEEEEEEEEECCCCCEEEEEEEE
1jmxB792805EE6.48063380.227072156.513219314.616143
SeqLYLGGTFNDLAVFN
SSEEEEECCCCEEEEEE
2cfuA247267EE5.86454779.817799142.533119314.208908
SeqVPFTFQNTPGTESPAEMNIWL
SSEEEEEEEECCCCCCCCEEEEEE
4gqbB816833EE6.51526177.988240150.061874310.802623
SeqPTSLAWHPQQSEVFVFGD
SSEEEEEEECCCCCCEEEEEE
2xp1A123141EE6.64409171.751908151.019815310.784332
SeqVYAFYFSRKYPGKLTFAYN
SSEEEEEEECCCCCCEEEEEEE
1oacA3346EE7.31072076.534652152.055483304.471575
SeqAYVKVKPGAQTAIV
SSEEEEEECCCCCEEEE
2pbiB473489EE6.49381880.202310152.973533314.244786
SeqVLCMDWCKDKRRIVSSS
SSEEEEEEECCCCCEEEEEE
3cwxA4060EE7.30223281.698282149.808407310.748109
SeqLNVEIQINPEVKDFFTFKSIS
SSEEEEEEECCCCCCCCEEEEEEE
3ot9A147162EE6.27350880.783029141.844127315.936910
SeqLIVYTSADSVLQIAAH
SSEEEEEECCCCEEEEEEE
2hzqA6485EE5.48548687.309628137.634891312.867880
SeqVNQIEGEATPVNLTEPAKLEVK
SSEEEEEEEEEEECCCCCCCEEEEE
2bklA120140EE5.56404583.441397156.426950314.583180
SeqVSLGTWAVSWDGKKVAFAQKP
SSEEEEEEEEECCCCCEEEEEEEE
2okcA308335EE6.55646878.493718153.239548313.935843
SeqFNLHTILRLPTGIFYAQGVKANVLFFSK
SSEEEEEEEEECCCCCCCCCCCCEEEEEEEE
1m9zA7690EE7.29412782.188080132.187873310.750281
SeqKEKKKPGETFFMCSC
SSEEEECCCCCEEEEEEE
4gqbB775792EE6.61537374.727662155.595154313.154417
SeqVTCVAASPHKDSVFLSCS
SSEEEEEEECCCCCCEEEEEE
1qksA292308EE6.86107678.773372155.540156307.124965
SeqVAAILASHYRPEFIVNV
SSEEEEEEECCCCCEEEEEE
4gqbB733749EE6.30697174.768439153.832896315.266864
SeqVSTVSVLSSGTQAVSGS
SSEEEEEEECCCCCEEEEEE
2r2zA6078EE6.98509983.770835145.669353312.025843
SeqIKLTAEEEGTRLLVLRVHF
SSEEEEEECCCCCCCCEEEEEE
1mg4A5479EE6.94106682.078393137.995615311.824564
SeqTIYTIDGLKKISSLDQLVEGESYVCG
SSEEEEECCCCCCCCCCCCCCCCCEEEEE
2qyuA369383EE6.83645178.538760143.262208315.638972
SeqFLLLSSQDSDTAMML
SSEEEEECCCCCCEEEEE
From residue 49 to 74 type EH
jmol
SSEEEEEEEEEEECCCCCCCCCHHHHHHH
Distance11.089426Delta81.429468
Theta171.614128Rho155.513608
Geometrically equivalent Smotifs
PDBChainStartEndTypeDDeltaThetaRho
3ha2A224EH11.50515178.029199174.178187145.294723jmol
SeqTLIIVAHPELARSNTQPFFKAAI
SSEEEEEECCCCCCCCCCHHHHHHHH
3vhvA156184EH12.24379395.227900163.494617185.909130jmol
SeqTIPKDGLKSQAAFEEMRTNYIKELRKMVT
SSEEEECCCCCCHHHHHHHHHHHHHHHHHHHH
3obeA215240EH11.24256681.865836167.677338186.473457jmol
SeqLLHIKDRWIIGDSGNFPNIFKKAYEI
SSEEEEECCCCCCCCCCCHHHHHHHHHHH
1n2zA6079EH10.92702176.870133159.760365181.527003jmol
SeqLVIAWRGGNAERQVDQLASL
SSEEEEECCCCCCHHHHHHHHHH
2nq5A278306EH10.05546767.144217176.251362126.767818jmol
SeqEIFAGVIDGRNIWSSDFVKTSALLETIEE
SSEEEEEEEECCCCCCCCCHHHHHHHHHHHHH
1p9lA4867EH10.66339972.638359173.433252150.436737jmol
SeqVVIDFTHPDVVMGNLEFLID
SSEEEEECCCCCCHHHHHHHHHH
4fqdA111127EH12.05433270.908833167.157482125.679897jmol
SeqVARLSARPDEHLLDVMG
SSEEEEECCCCCHHHHHHHH
1zgzA94116EH10.45714786.065085167.107699162.069248jmol
SeqDYVTKPLELRELVVRVKNLLWRI
SSEEEEECCCCHHHHHHHHHHHHHHH
1vluA226244EH11.11719567.505708165.225010181.483503jmol
SeqSIYLDEDADLIKAKRISLD
SSEEEEECCCCCHHHHHHHHHH
4ei7A4760EH10.47053672.227563169.623351125.023976
SeqRAILVNTNSQDFNK
SSEEEEEEECCCHHHHH
3t8jA323EH9.79516467.701317170.731396141.566653
SeqHFIIDCDTAEDDVLSLYLLLK
SSEEEEEEECCCHHHHHHHHHHHH
3q2iA1232EH10.15270089.292188167.261060147.007625
SeqIRFALVGCGRIANNHFGALEK
SSEEEEEEECCCCCHHHHHHHHHH
1mv8A315344EH10.76928373.116448166.218356170.129325
SeqKVGLLGLSFKAGTDDLRESPLVELAEMLIG
SSEEEEEECCCCCCCCCCCCCCHHHHHHHHHHH
3ni2A118138EH10.28511689.251994161.881541165.488026
SeqAKLLITQACYYEKVKDFARES
SSEEEEEEECCCCCHHHHHHHHHH
1srrA99116EH9.97330684.260612167.762183142.655144
SeqHFAKPFDIDEIRDAVKKY
SSEEEECCCCHHHHHHHHHHH
3h4tA286302EH10.23768068.761965170.130340151.831665
SeqAVVHHGGAGTTTAVTRA
SSEEEEECCCHHHHHHHHHH
2aefA218EH10.43152869.562648164.502254133.965354
SeqHVVICGWSESTLECLRE
SSEEEEEECCCHHHHHHHHH
2vqmA174191EH10.79493887.248637169.459066166.068159
SeqILIVDWDVHHGNGTQQAF
SSEEEEEECCCCCCHHHHHHH
4j27A312346EH11.93312367.565011157.753795178.622228
SeqNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKA
SSEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHH
3dkpA210229EH10.79984588.541296170.079709170.261747
SeqRRAMFSATFAYDVEQWCKLN
SSEEEEEEECCCCHHHHHHHHHH
1dbqA122141EH11.47558771.195919170.715985147.314775
SeqIGVIPGPAGRLAGFMKAMEE
SSEEEEECCCCHHHHHHHHHHHH
3n53A88115EH10.66330086.371547170.847717160.125821
SeqDYLTKPFNRNDLLSRIEIHLRTQNYYSD
SSEEEEECCCCHHHHHHHHHHHHHHHHHHHH
2pw6A325EH10.49075567.069310159.461266159.063005
SeqALFLGHGPNVLEDNLYTRSWQKL
SSEEEEEECCCCCCCCCHHHHHHHHH
3ip3A217EH10.01818494.583403167.618334150.554458
SeqLKICVIGSSGHFRYAL
SSEEEEEEECCCCCHHHHH
3jrnA328EH11.09145793.759304174.571244181.320391
SeqYDVFLSFRGHDTRHNFISFLYKELVR
SSEEEEEEEECCCCCCCCHHHHHHHHHHH
2fnoA929EH9.70280482.057315158.046304131.618835
SeqFDLYYWPVPFRGQLIRGILAH
SSEEEEECCCCCCCCHHHHHHHHH
2wolA2756EH11.84486479.674746159.511229157.468302
SeqTLRLVSSADVDSLDPARTYYVWVWLLQRLL
SSEEEEEEECCCCCCCCCCCCCCHHHHHHHHHH
3qvpA1736EH10.03900869.405119163.687135141.288819
SeqTVDYIIAGGGLTGLTTAARL
SSEEEEEEEECCCHHHHHHHHHH
2wvgA93127EH10.18711392.597136165.172461142.851287
SeqVILISGAPNNNDHAAGHVLHHALGKTDYHYQLEMA
SSEEEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHH
2bllA2741EH10.66905691.353678158.523884173.568291
SeqEVYGLDIGSDAISRF
SSEEEEEEECCCHHHHHH
2hoxA156174EH9.96925180.850004166.613225146.527250
SeqSKVVAHAPFYPVFREQTKY
SSEEEEEECCCCCHHHHHHHHH
2d5wA740EH10.67045668.460606162.889087125.004800
SeqSLVIGASQEPRVLAGDFLRVISNQAIKSEIEQYL
SSEEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHH
3ni2A7293EH10.51021678.440361172.641414171.156877
SeqVIMLFLPSSPEFVLAFLGASHR
SSEEEEEECCCCHHHHHHHHHHHHH
2vqeB16691687EH9.64704683.365916158.448733174.675466
SeqAIFVVDPTKEAIAVREARK
SSEEEEECCCCCCHHHHHHHHH
3c97A100119EH9.93877880.101090173.152121177.896918
SeqEYVSKPLNPNQLRDVVLTCH
SSEEEEECCCCHHHHHHHHHHHH
2q40A194220EH10.90181694.747123177.169012155.084317
SeqKAVIFVDNSGADIILGILPFARELLRR
SSEEEEEECCCCCCCCCCCHHHHHHHHHHH
3js8A435464EH11.43525688.161264172.829939127.519147
SeqVAVWLDILTLPGTPYANQFYREIEQWIEAN
SSEEEEEEEEEECCCCCCHHHHHHHHHHHHHHH
2fnuA7693EH10.33736282.094153169.722461155.831901
SeqEIITTPISFVATANMLLE
SSEEEEECCCCCCHHHHHHHH
From residue 68 to 83 type HE
jmol
SSEHHHHHHHCCEEEEEEE
Distance8.430270Delta74.310753
Theta135.513624Rho80.876953
Geometrically equivalent Smotifs
PDBChainStartEndTypeDDeltaThetaRho
3jyoA187199HE7.56213888.764639144.88746490.282710jmol
SeqIEDVIAAADGVVN
SSEHHHHHHHCCEEEE
2rbkA233242HE7.09026279.422296134.32287657.773317jmol
SeqEDVKAAADYV
SSEHHHHHHCCEE
3louA170186HE9.31496972.923587126.483985103.528422jmol
SeqPEASARLANRAINIHHS
SSEHHHHHHCCCCEEEEEEE
1wzuA2636HE7.22855273.043235133.38351685.389309jmol
SeqPEVQDIADFIG
SSEHHHHHHCCEEE
1m3sA2443HE8.64791785.895844127.950085106.214891jmol
SeqNEEADQLADHILSSHQIFTA
SSEHHHHHHHHHHHHHCCCEEEE
1mx3A197209HE7.92802080.989086146.48616866.726961jmol
SeqLQDLLFHSDCVTL
SSEHHHHHHHCCEEEE
3al2A162173HE8.52246788.031918131.30398571.414131jmol
SeqVPLFKEATHLFS
SSEHHHHHHCCEEEE
2fsuA91105HE9.91461969.937538144.69836558.608963jmol
SeqSEQLNALSGATLILQ
SSEHHHHHHCCCCEEEEE
3h4tA277289HE7.67956185.495201133.22217169.026023jmol
SeqHQVLFGRVAAVVH
SSEHHHHHHHCCEEEE
1m3sA119129HE7.03749161.633154133.466894111.710678jmol
SeqSIGKQADLIIR
SSEHHHHHCCEEEE
1kblA432446HE7.84351187.656035137.47346059.107090jmol
SeqPEDIEGMHAAEGILT
SSEHHHHHHHHHCCEEEE
3ctzA294308HE8.43699770.371744140.76055370.235608jmol
SeqYAVSETIPKDHRCCM
SSEHHHHHHCCCCCEEEE
3ix9A102120HE8.39307089.271958138.840163109.909574jmol
SeqKQIFQAFEPYLDEVIVTHI
SSEHHHHHHHHHHCCEEEEEEE
3bq9A230246HE7.37590560.467973120.55817571.954467jmol
SeqIEKRLEAFVRCAHGIVI
SSEHHHHHHHHHHHCCEEEE
2bllA5973HE7.26483469.470891133.76228574.009940jmol
SeqEWIEYHVKKCDVVLP
SSEHHHHHHHHHCCEEEE
3gwqA370383HE8.49426783.806098136.44348659.659165jmol
SeqPCLTFDKWRQVLVV
SSEHHHHHHHCCEEEEE
3mc3A8599HE8.46015686.550327128.59187995.979088jmol
SeqSTLIDLTLEADRTLF
SSEHHHHHHHHHCCCEEE
3n75A246262HE8.89763787.429016147.19996698.836459jmol
SeqKSLTHLMMMSDVTPIYF
SSEHHHHHHHHHCCCEEEEE
3iv4A1432HE7.24483962.015703150.08854096.380324jmol
SeqIDQFEQVIEENKYVFVLKH
SSEHHHHHHHHHHCCEEEEEEE
1o6dA107118HE7.81614875.032760126.21608970.993541jmol
SeqEEIFAKAHRVFS
SSEHHHHHHCCEEEE
1sqsA6988HE7.33915559.837656126.964889109.596707jmol
SeqGGVIKKELLESDIIIISSPV
SSEHHHHHHHHHHCCEEEEEEEE
2uz1A190210HE7.77953177.886922130.569844107.695583jmol
SeqPADLDQALALLRKAERPVIVL
SSEHHHHHHHHHHHHHCCCEEEEE
3a1jC732747HE8.40244588.227280148.98383477.257414jmol
SeqSTKALVLSCKVSIRTD
SSEHHHHHHHCCEEEEEEE
1mv8A384396HE8.07127581.615627146.32442170.866568jmol
SeqLDEVVASSDVLVL
SSEHHHHHHHCCEEEE
4idhA123144HE9.14136376.214033149.37227364.390160jmol
SeqKESWDILIPTIRKPFSEIWVSF
SSEHHHHHHHHHHCCCCCCEEEEEE
2p4gA4463HE7.31896271.032945125.15324075.349472jmol
SeqQTDADLLIQLRGWADAIVVG
SSEHHHHHHHHHHHHHCCEEEEE
1e6cA125152HE7.95656874.841866135.95912277.849301jmol
SeqGRPIAEEMEAVLREREALYQDVAHYVVD
SSEHHHHHHHHHHHHHHHHHHHHHHCCEEEE
3s1sA572590HE9.42761467.010778123.584683111.442182jmol
SeqNGRVAEEWITNNLESHCIR
SSEHHHHHHHHHHHHCCCCEEE
3fduA112125HE7.49872775.766478139.419705106.485009jmol
SeqIGVTILLQADLVFA
SSEHHHHHHHHCCEEEE
1yc5A420HE8.67200671.849944123.79011398.291612jmol
SeqKEFLDLLNESRLTVTLT
SSEHHHHHHHHHCCCEEEEE
3l4eA6984HE7.07223160.266420123.78661591.203161jmol
SeqLGEITTKLRKNDFIYV
SSEHHHHHHHHHHCCEEEE
3c1aA124147HE7.50057373.019642127.39179082.894143
SeqPAWEALKADLTSIGPILAVRSEAG
SSEHHHHHHHHCCCCCCCEEEEEEEEE
2wvgA2945HE7.92903164.667639142.48202195.573909
SeqLVLLDNLLLNKNMEQVY
SSEHHHHHHHHCCCCCEEEE
4k37A100116HE8.56067582.589276136.370652105.725615
SeqESWAKFLSENKFLVGLS
SSEHHHHHHHHHCCCEEEEE
3sqdA5467HE9.66925360.328496136.945978106.098435
SeqVKFLTAISVVKHIV
SSEHHHHHHCCCCCEEE
3fduA156169HE8.98124788.191800134.99058597.191441
SeqYHKAAELLFTAKKF
SSEHHHHHHHHHHCCEE
4fqdA120135HE7.24594486.073437139.20126197.268597
SeqEHLLDVMGRFGVTTRL
SSEHHHHHHHHCCCCEEEE
3axbA156176HE7.57334685.795109124.687484103.533854
SeqAEKVVDYYYRRASGAGVEFIF
SSEHHHHHHHHHHHHHHCCCEEEE
2avwA185206HE7.43147477.670438149.880145101.224502
SeqLKEISDLIKKELTEGKALGLSH
SSEHHHHHHHHHHHHHCCCEEEEEE
2yjzA4961HE8.32612072.899873149.32775376.586708
SeqYSEAASRSDVIVL
SSEHHHHHHCCCEEEE
2cc0A4661HE7.24535986.869298137.73618891.066526
SeqPSLVRAQVDAGMWVAN
SSEHHHHHHHHHCCCEEEE
1nlfA120139HE8.14765959.412217137.44228755.661603
SeqPEWFDGLKRAAEGRRLMVLD
SSEHHHHHHHHHHHCCCCEEEEE
2phpA97111HE8.91351981.059500140.736873104.730871
SeqGGLIKLLKDKFAVSS
SSEHHHHHHHCCCCCEEE
1qmeA6482HE7.28565183.437415124.712122108.835700
SeqNSILAGTDGRTMDGKDVYT
SSEHHHHHCCCCCCCCCCEEEE
2re7A99127HE9.72431277.304707137.56074474.947519
SeqPVYSAFFANGKEDANIQLIKVVPHGVECW
SSEHHHHHCCCCCCCCCCEEEEEEEEEEEEEE
1luaA205219HE9.43045763.491696143.26192862.028349
SeqQAAWQNESSIEIVAD
SSEHHHHHCCCCCCEEEE
2woyA139156HE8.85510476.337486134.03497084.254002
SeqSEFGKTGGKYENKAYQID
SSEHHHHHCCEEEEEEEEEEE
2zyjA126145HE8.34678775.198337150.16362462.871638
SeqMGAIQAFRLQGPRFLTVPAG
SSEHHHHHHHHCCCCEEEEEEEE
3nuqA135156HE8.82605579.949473140.05667287.296061
SeqIPLRNMLLRLRQSGKIDKLWLF
SSEHHHHHHHHHHHHCCCCCEEEEE
3fduA86105HE9.18705472.965114128.114215106.775947
SeqPPFVLLKSAARLSKPLIIAV
SSEHHHHHHHHHHHCCCCEEEEE
2om6A101119HE7.41533481.147730140.62385193.845166
SeqTKEALQFVKERGLKTAVIG
SSEHHHHHHHHHHCCCEEEEEE
2z0xA117128HE8.71077381.995675128.18556090.860815
SeqEDLLGYPEVWAA
SSEHHHHHCCCEEEE
2f8mA107125HE8.44079976.763066134.56303387.509105
SeqLVREKLVASSSSLLIIIGD
SSEHHHHHHHHHCCCCEEEEEE
1wddS486508HE7.17202385.917682136.61349191.672444
SeqVEDLLKQIEYLLRSKWVPCLEFS
SSEHHHHHHHHHHHHHCCCEEEEEEE
2c1lA8299HE7.40198687.114443148.500661108.968024
SeqRQVVEELLNRGVEVHIIN
SSEHHHHHHHHHCCCEEEEEE
4ed9A8098HE7.95597563.721791133.349300105.417805
SeqEEGRELVRRLVAEADVVIE
SSEHHHHHHHHHHHHCCCEEEE
1m93B6679HE8.48030588.159073123.24741270.379994
SeqDSFLRKIGDNFQTV
SSEHHHHHHHCCCEEEE
2hoxA131160HE8.88206970.396925150.20716255.344931
SeqGVTQLIHGLVISLSPNMTATPDAPESKVVA
SSEHHHHHHHHHHHHHCCCCCCCCCCCCEEEEE
2wvgA191215HE9.86761469.099295129.75820965.118338
SeqEASLNAAVEETLKFIANRDKVAVLV
SSEHHHHHHHHHHHHHHHCCCCCEEEEE
3lnlA8298HE7.70678989.055878125.489267101.285295
SeqYGLIIRKLIQHDINLIA
SSEHHHHHHHHHHCCCEEEE
1d5rA85110HE7.24735780.741056145.43644880.596852
SeqLELIKPFCEDLDQWLSEDDNHVAAIH
SSEHHHHHHHHHHHHHHHCCCCCCEEEEE
1wzaA315335HE9.50765879.766567146.43557797.553552
SeqRNKARVAASIYLTLPGNPFIY
SSEHHHHHHHHHHHCCCCCCCEEE
1mv8A7082HE7.91246075.940648142.35927980.136935
SeqFKKAVLDSDVSFI
SSEHHHHHHCCCEEEE
4e2oA189210HE8.98844586.624417148.95139150.138858
SeqKSFWQEFAKEVKSVKKDFFLLG
SSEHHHHHHHHHHHCCCCCCCEEEE
3vayA110127HE7.68147265.576488136.750456104.269857
SeqVQPTLEILAKTFTLGVIT
SSEHHHHHHHHHCCCEEEEEE
From residue 77 to 104 type EH
jmol
SSEEEEEEEECCCHHHHHHHHHHHHHHHHHH
Distance6.392446Delta73.536257
Theta163.847026Rho135.112063
Geometrically equivalent Smotifs
PDBChainStartEndTypeDDeltaThetaRho
1nsjA99118EH7.56979861.609658161.602442143.478403jmol
SeqLVIKAVGVSNERDMERALNY
SSEEEEEEEEECCHHHHHHHHHH
2i0fA6698EH7.53583688.425022152.483837158.696291jmol
SeqGFVALGTVIRGETYHFDIVSNESCRALTDLSVE
SSEEEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHH
3q72A5075EH6.49713161.133116161.648263104.540315jmol
SeqAYVIVYSVTDKGSFEKASELRVQLRR
SSEEEEEEEECCCHHHHHHHHHHHHHHHH
1g6hA227243EH6.37174265.652049154.225221106.702891jmol
SeqQIIAEGRGEEEIKNVLS
SSEEEEEEEECHHHHHHHHH
3ix9A96111EH6.57226564.449949150.416713130.716692jmol
SeqLYIVGGKQIFQAFEPY
SSEEEEEECHHHHHHHHHH
2grvA354379EH7.30643967.072563158.405287159.028228jmol
SeqTIVLGVASNDPTSVAVANTAADQLRN
SSEEEEEEEECCCHHHHHHHHHHHHHHHH
3u4gA644EH7.58439384.856390154.648208122.548855
SeqLFLLVLGNTEISTIPGISVAGATPELTKITPVADAEYLF
SSEEEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
1rvv140784111EH7.14173163.733864157.197252150.953900
SeqAIITLGTVIRGATTHYDYVCNEAAKGIAQAANTT
SSEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHH
2a9gA356372EH7.45464468.466648150.274858119.722957
SeqVVVGYDRNTYTNTLLRK
SSEEEEEECCCHHHHHHHHH
2gn0A7998EH7.48784564.643311156.497995125.570590
SeqVVACSAGNHAQGVSLSCAML
SSEEEEECCCHHHHHHHHHHHHH
1dz3A7896EH6.52308287.383223152.351043135.350885
SeqNVIMLTAFGQEDVTKKAVE
SSEEEEEEEECCCHHHHHHHHH
2i3dA144167EH7.81948286.231021154.393132136.301666
SeqGLIINGDADKVAPEKDVNGLVEKL
SSEEEEEEECCCCCCCHHHHHHHHHHH
1b1cA138165EH6.65422077.854767164.967604110.840645
SeqGLGDDDGNLEEDFITWREQFWPAVCEHF
SSEEEEECCCCHHHHHHHHHHHHHHHHHHHH
From residue 87 to 116 type HE
jmol
SSEHHHHHHHHHHHHHHHHHHCCCCCCEEEEEE
Distance14.690984Delta129.424149
Theta177.839438Rho294.976631
Geometrically equivalent Smotifs
PDBChainStartEndTypeDDeltaThetaRho
2vq5A4262HE13.813668134.518422175.794340297.423747
SeqPGLAKHLPDLLPGAFEKLEII
SSEHHHHHHHHHHCCCCCCCCCEE
4eclA164195HE14.822424117.894702167.950704304.454542
SeqENDVAFTNKQIGSFYKVLDWLKSSGLNIPKVH
SSEHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEE
4ammA127157HE15.677169115.561621169.147729324.311490
SeqTAVAQPAIIADSLAGIRWLDRLGARPVGALG
SSEHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
3do8A97119HE15.260494140.368345177.095818318.489957
SeqYEMALKINQKREELGKRKITIVK
SSEHHHHHHHHHHHHHHCCCCCEEEE
3lwaA94112HE13.339855119.770126164.006252312.914051
SeqRDIAQDFVTDNGLDYPSIY
SSEHHHHHHHHHHCCCCCCEEE
From residue 111 to 137 type EH
jmol
SSEEEEEEECCCCCCCCCCHHHHHHHHHHH
Distance10.917627Delta98.513234
Theta166.927238Rho328.620008
Geometrically equivalent Smotifs
PDBChainStartEndTypeDDeltaThetaRho
2fnuA122147EH11.404516103.338893175.838502301.318196jmol
SeqTKAIVSVDYAGKSVEVESVQKLCKKH
SSEEEEEEEECCCCCCCCHHHHHHHHHHH
1cp2A175200EH10.93578899.129829154.142209339.024335jmol
SeqRLGGIICNSRKVANEYELLDAFAKEL
SSEEEEEEEEECCCCCCCHHHHHHHHHHH
1k07A6386EH10.04240691.901227169.871748336.884383jmol
SeqTKILLISHAHFDHAAGSELIKQQT
SSEEEEEECCCCCCCCCCCHHHHHHHH
4k37A281293EH9.67805686.031035178.137272307.584402jmol
SeqGNIQDMTMKELFE
SSEEECCCCCHHHHHH
3q72A81107EH10.98495297.082182169.378907325.696777jmol
SeqIILVGNKSDLVRSREVSVDEGRACAVV
SSEEEEEEECCCCCCCCCCCHHHHHHHHHH
2vozA228252EH12.38826585.317450173.565339357.667560jmol
SeqVNVSGAGVLKNAPNRDAAIAFLEYL
SSEEEEEEEEEECCCCCHHHHHHHHHHH
3do5A4455EH10.51872287.756522164.220883340.973691jmol
SeqSISGDFSLVEAL
SSEEEECCCCHHHHH
3hsuA102119EH10.94233684.312696156.979336351.986106jmol
SeqATIQGGARLGYTALELLD
SSEEEEECCCCHHHHHHHHHH
2vw8A6486EH11.59085991.014223174.854305342.187039jmol
SeqVHYWLITHKHYDHCGLLPYLCPR
SSEEEEEECCCCCCCCCCCHHHHHHH
2hr7A422443EH11.54983999.112682173.899665323.375320jmol
SeqKLFFHYNPKLCLSEIHKMEEVS
SSEEEEEECCCCCCHHHHHHHHHHH
3m0zA111150EH10.59660889.924682170.523910332.887829jmol
SeqVVNGLVSPTGTPGVKISTGPLSSGAADGIVPLETAIALLK
SSEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
3s5oA205226EH11.94825184.197997158.970774314.728945jmol
SeqGGVCALANVLGAQVCQLERLCC
SSEEEECCCCCCCHHHHHHHHHHHH
3kizA74103EH11.63515591.057360159.323375337.857087
SeqILLSSTIGRNKNLIPGEVLAAIINGTEEVL
SSEEEEEEEEEECCCCCCHHHHHHHHHHHHHHH
4kefA111132EH12.039307107.607956152.638838315.663637
SeqTDVQGTDFSEVSYDSVLERVSR
SSEEEEEECCCCCCCHHHHHHHHHH
2vzyA86116EH9.965008104.187155157.352826347.246666
SeqQVDSGSWLGLRYQGHGYGTEMRAAVLYFAFA
SSEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHH
4e6wA300326EH9.94201194.951879155.132893337.589196
SeqIGIVALANMNSNLILQLCADIDNYLRI
SSEEEEEEEECCCCHHHHHHHHHHHHHHHH
3duwA5874EH10.71417689.982558171.528460299.387521
SeqNILEIGTLGGYSTIWLA
SSEEEEEECCCCCHHHHHHH
2zkmX505527EH11.360093100.369918173.354759338.155024
SeqMSRIYPKGTRMDSSNYMPQMFWN
SSEEEEEECCCCCCCCCCCCCHHHHH
1iz0A186201EH9.60091489.017307164.579384298.330190
SeqLDLVLEVRGKEVEESL
SSEEEEEEECCCCCHHHHH
2fshA241260EH12.34102297.917083154.989307346.342450
SeqKLAGMTGTADTEAFEFSSIY
SSEEEEEEECCCCCCHHHHHHHH
4bmaA98149EH12.31757787.010338171.959146348.930531
SeqVAVVLMAGGQGTRLGSSAPKGCFDIGLPSHKSLFQIQAERIAKLQLLAQRIS
SSEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
4gklA191203EH11.08855790.857732162.064376325.897053
SeqIWISETHDPYMYQ
SSEEEEEECCCHHHHH
1srrA7594EH10.51487986.502499176.568704318.739792
SeqRVIIMTAYGELDMIQESKEL
SSEEEEEEECCCCHHHHHHHHHH
2om6A142164EH11.001603101.041140153.456217345.504882
SeqKTFFADEVLSYKPRKEFEKVLNS
SSEEEEECCCCCCCCCCCCCHHHHHH
4dv8A401436EH9.60468685.606422166.490756338.513031
SeqSILLHGPSKGVELRNDSEGFIHEFGHAVDDYAGYLL
SSEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
4e12A153176EH11.14160085.954710161.576783322.530747
SeqTAEVMGTTKTDPEVYQQVVEFASA
SSEEEEEEECCCCCHHHHHHHHHHHHH
2xdqB513539EH10.35571888.524101158.766534358.228942
SeqLIVLTPTCTSSILQEDLQNFVRRASLS
SSEEEEEECCCCCCCCCCCHHHHHHHHHHH
3l4eA320EH11.12916793.309663159.664318336.101934
SeqNLFLTSSFKDVVPLFTEF
SSEEEEEECCCCCCHHHHHHH
2xapA689714EH12.00862186.619322156.525011330.341411
SeqNYDPSRFPSGKVPMQQLLKDLLTAYK
SSEEECCCCCCCCCCCHHHHHHHHHHHHH
2aamA1022EH12.26118795.683831164.239192312.171177
SeqLYQLQNADPVEIS
SSEEEECCCCCHHHHH
3gwqA151180EH12.24057783.911494163.932733324.113839
SeqLQVLLELGVPGGRTGVRDAAQRNAVLEAIT
SSEEEEEEEECCCCCCCCCCCHHHHHHHHHHHH
4fazA231EH10.14871587.667984161.567127354.824598
SeqFAQIYLIEGRTEEQKRAVIEKVTQAMMEAV
SSEEEEEEEECCCCHHHHHHHHHHHHHHHHHHH
3c1aA139167EH10.71022091.363142158.497150328.742257
SeqILAVRSEAGNHGPYRPGGVPLWDWGAHDV
SSEEEEEEEEEECCCCCCCCCCCCCHHHHHHH
1luaA424EH10.905225103.988564160.728257356.093438
SeqLLFQFDTDATPSVFDVVVGYD
SSEEEEEEECCCCCCHHHHHHHHH
3lnlA4158EH10.77049386.678941165.468459322.194212
SeqVLTALDCTLEVVNEAIEK
SSEEEEECCCCHHHHHHHHHH
1jvnA626EH11.12951691.841201176.529029334.993665
SeqVVHVIDVESGNLQSLTNAIEH
SSEEEEEECCCCCCCHHHHHHHHH
2hc9A245289EH10.62268992.387891152.021922307.456903
SeqHIALVGKGVVYDTGGLQIKTKTGMPNMKRDMGGAAGMLEAYSALV
SSEEEEEEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
2olrA194217EH11.121004111.190170152.582834347.299965
SeqMQLIGGTWYGGEMKKGMFSMMNYL
SSEEEEEECCCCCHHHHHHHHHHHHHH
2pg3A2652EH10.69905485.845604176.721804346.109023
SeqDVHCITFDYGQRHRAEIEVAQELSQKL
SSEEEEEEEEECCCCCHHHHHHHHHHHHHH
3cnhA127148EH10.84589684.931264160.750874335.539724
SeqFFTSSALGVKPNPAYRLGLTLA
SSEEEECCCCCCCCCCCCHHHHHHH
1wcwA125145EH11.59295394.925202169.504190303.996542
SeqGVAALQLYGKPLPLLENALAE
SSEEEEEEECCCCCCHHHHHHHHH
From residue 127 to 143 type HE
jmol
SSEHHHHHHHHHHHCCCEEE
Distance10.324832Delta133.198032
Theta145.904416Rho52.326034
Geometrically equivalent Smotifs
PDBChainStartEndTypeDDeltaThetaRho
2znrA100122HE10.172235127.499355147.21169671.599654jmol
SeqSVDLHTHCSYQLMLPEAIAIVCS
SSEHHHHHHHHHHHHHCCCCEEEEEE
2pt5A1128HE10.689296137.498063158.79364344.810282jmol
SeqKSTVGSLLSRSLNIPFYD
SSEHHHHHHHHHHHHCCCEEE
4hktA297321HE10.774170131.842442155.56952021.671308jmol
SeqGNDGLAALALADAAVRSVAEKRQIS
SSEHHHHHHHHHHHHHHHHHHHHCCCEE
4g3vA7488HE11.151071128.378806154.57574163.935022jmol
SeqGITGKVFQRGIPLVI
SSEHHHHHHHHHCCCEEE
3qqyA202225HE10.168053129.625929152.11587048.509265jmol
SeqIKDKNLMNSLITYLGCGYIKEKNK
SSEHHHHHHHHHHHHHHCCCEEEEEEE
3cyjA278291HE11.486656130.111975148.55499051.423915jmol
SeqVDGICRGHQIPFSA
SSEHHHHHHHHCCCEEE
3au4A259288HE11.041686122.232710138.23666967.106883jmol
SeqVADVLAKFEKLAATSEVGDLPWKFYFKLYC
SSEHHHHHHHHHHHCCCCCCCCCCCEEEEEEEE
3hsuA4666HE10.297330122.643588149.10878164.708470jmol
SeqTEDIAAAVQCGLDAGVQISAK
SSEHHHHHHHHHHHHHHCCCEEEE
3o3mA349369HE11.744085125.705907155.48972243.072520jmol
SeqQYEMQRRAAEETGLPYAGFDG
SSEHHHHHHHHHHHHCCCEEEEEE
2ixsA185199HE11.026191126.931577135.69164830.868203jmol
SeqFMPRFAPGAKVLYIG
SSEHHHHHCCCCEEEEEE
2gn4A235250HE11.550914120.277735143.65653926.960061jmol
SeqMTDLAKALAPNTPTKI
SSEHHHHHHHHCCCCCEEE
2xi7A101132HE8.990696136.718324155.00177166.862615jmol
SeqESSVITYDKYYELTRDISDRLSIPIEIVIIRI
SSEHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEE
1cp2A190208HE10.297452142.271246134.18212877.560640jmol
SeqYELLDAFAKELGSQLIHFV
SSEHHHHHHHHHHHCCCEEEEE
1twfB23282348HE10.734707134.327634158.17608742.765495jmol
SeqVAHLIECLLSKVAALSGNEGD
SSEHHHHHHHHHHHHHHHHCCCEE
3ot9A108127HE10.239091133.621741136.59614864.595011jmol
SeqKELLDELEEKTGRKIIGNKP
SSEHHHHHHHHHHHCCCEEEEEE
1zinA1330HE11.421901132.636697156.75241473.874831jmol
SeqKGTQAEKIVAAYGIPHIS
SSEHHHHHHHHHHHHCCCEEE
4dzaA106129HE9.938763136.393076151.45620963.525158jmol
SeqLDMAKRLDAIAKQQNKVIPIHLAL
SSEHHHHHHHHHHHHHHCCCEEEEEEE
4dzhA199220HE11.475470125.137520143.92509581.544326jmol
SeqDANFERVRMLADQLDMPVHLHT
SSEHHHHHHHHHHHHHHCCCEEEEE
3s5oA192207HE9.902511124.331371159.28741529.950046jmol
SeqAGFLMASYALGAVGGV
SSEHHHHHHHHHHCCCEEE
3mwdB592610HE9.334627141.085461135.51509372.640259jmol
SeqNELNNIISRTTDGVYEGVA
SSEHHHHHHHHHHCCCEEEEEE
3o5yA5670HE10.629540125.412909150.46790735.959831jmol
SeqLYWSALDQRQTIFRS
SSEHHHHHHHHCCCEEEE
2x7iA142157HE10.291120125.766296149.63010661.173893jmol
SeqGIDTQTIVSGKPVWFQ
SSEHHHHHHHHHCCCEEEE
1s2wA2642HE11.114834122.087528159.10003140.897179jmol
SeqGLSARIVQEAGFKGIWG
SSEHHHHHHHHHHCCCCEEE
3louA5879HE11.522244124.654750156.50737529.224845jmol
SeqVDALRREFEPIAERFRQWAIHD
SSEHHHHHHHHHHHHHHHCCEEEEE
2gn4A177194HE10.968324126.934330150.54497966.162370jmol
SeqVVPFFKKLVQNKASEIPI
SSEHHHHHHHHHHHCCCCEEE
3e2qA200227HE11.129999131.926819151.56060681.498685jmol
SeqYDRVMEELYPRLKSLTLLARQYDIGINI
SSEHHHHHHHHHHHHHHHHHHHHHHCCCEEE
4ja8A185210HE10.722894126.094255150.73096853.858963jmol
SeqDESISGFAHSCFQYAIQKKWPLYMST
SSEHHHHHHHHHHHHHHHHHHCCCEEEEE
4gkbA4461HE10.986185119.762985141.06857882.206565jmol
SeqGAFLDALAQRQPRATYLP
SSEHHHHHHHHHHCCCCEEEE
3w5jA129142HE9.990363138.423452153.41058827.175952jmol
SeqSRKMSELLQIPVFQ
SSEHHHHHHHHCCCEEE
3ot9A130151HE9.615520131.309181153.87466759.127989jmol
SeqGTEILDELGQEQMETGSLIVYT
SSEHHHHHHHHHHHHHHHCCEEEEE
4hnoA81108HE10.399325121.636388151.11283425.680501jmol
SeqDDIWQKSVELLKKEVEICRKLGIRYLNI
SSEHHHHHHHHHHHHHHHHHHHHHCCCEEEE
4ioyX92129HE10.435877129.000530147.20306975.546740
SeqELEQEQEERRKRAALDKEFKYFADAIAEASNGLLTVEN
SSEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEE
1sg6A4274HE9.503353136.608335157.35929967.502211
SeqTNIGSIYTPSFEEAFRKRAAEITPSPRLLIYNR
SSEHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEE
3mwbA248271HE10.160383123.960233149.55951978.875091
SeqSRVADALAGLHRISPATRFLGSYA
SSEHHHHHHHHHHHHHCCCCEEEEEEE
1th8B189212HE10.044161126.762875140.28689682.029364
SeqSSGLGVILGRYKQIKNVGGQMVVC
SSEHHHHHHHHHHHHHHHHCCCCEEEE
1v72A96108HE9.738811119.294996146.75495847.917050
SeqAPEFFSNGAKLMT
SSEHHHHHCCCCEEEE
3gr4A396419HE11.709191124.125754156.66926961.222192
SeqPTEATAVGAVEASFKCCSGAIIVL
SSEHHHHHHHHHHHHHHHCCCCCEEEE
1hi9A133154HE10.435619142.569811139.46932269.320103
SeqELGLNAYVAGYYDVPVLMVAGD
SSEHHHHHHHHHHHCCCCEEEEEEE
2w5qA114130HE9.240311127.987552149.58714368.089071
SeqLPAILDQKQGYKSDVMH
SSEHHHHHHHHHCCEEEEEE
3f2bA128145HE10.279282120.936707160.82924152.655234
SeqVTKLIEQAKKWGHPAIAV
SSEHHHHHHHHHHCCCCCEEE
1sdoA86111HE10.178727133.378153158.76546251.353217
SeqPEEQKKVIEAAGKEALKSYNQTDFVK
SSEHHHHHHHHHHCCCCCEEEEEEEEEEE
1dysA241264HE10.369797135.539559151.33238830.880121
SeqESRYATNIANAMRQRGLPTQFIID
SSEHHHHHHHHHHHHHCCCCCCEEEEE
2zyrA83115HE10.895714129.847764131.89692531.609356
SeqRERLIDETFSRLDRVIDEALAESGADKVDLVGH
SSEHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEE
3p09A222HE8.956995118.765562145.38599623.562931
SeqLDDSFKNLENKYDGKIGIYTL
SSEHHHHHHHHHHHHCCEEEEEEE
2fshA253266HE9.445461133.065559144.80262748.408143
SeqAFEFSSIYKLDTVV
SSEHHHHHHHHCCEEEE
2bjqA8297HE9.137958127.393265131.68322778.890906
SeqPTEQFKKTGFWYEWRP
SSEHHHHHHHHCCEEEEEE
3au4A186204HE10.617561118.901373150.12744063.988737
SeqRDEIEALIHRQEMTSTVYC
SSEHHHHHHHHCCCCEEEEEEE
1mkmA77101HE9.504738125.052980153.70623233.024941
SeqIRDIAHDHLVDIMKRTGETVHLILK
SSEHHHHHHHHHHHHHHCCCCCEEEEEE
1iugA139158HE10.136238121.023766155.75234736.706144
SeqLPALARAFKEKNPEGLVGAD
SSEHHHHHHHHHHHCCCCEEEEE
1tzpA5376HE10.813473126.359166154.74052581.349851
SeqPDLVMFIQRLSSQVSNLGMGTVLI
SSEHHHHHHHHHHHHHHHHCCCCCEEE
3h4tA236254HE10.137811119.354032160.87141034.287748
SeqAARVAIEAVRAQGRRVVLS
SSEHHHHHHHHHHHCCCCEEEE
3ceuA144157HE10.425499120.988430153.19966147.622041
SeqLLEIKDFGFGGAVV
SSEHHHHHHCCCCCEEE
3e2qA268291HE9.833528120.821035158.56512178.052140
SeqCPLVIDYLIDLATRSRRRLMIRLV
SSEHHHHHHHHHHHHHHCCCCEEEEEE
4e4rA175197HE11.082828128.422158155.28870927.989574
SeqSQGLAEIAVESAKSALSFGDPKV
SSEHHHHHHHHHHHHHHHHHCCCCEE
2znrA1744HE10.161068130.209173154.39412560.104324
SeqLCHKFLQLAESNTVRGIETCGILCGKLT
SSEHHHHHHHHHHHHHCCCCCCEEEEEEEEE
2pgwA273286HE11.075923130.217046155.62956474.880176
SeqAAAVAEAAGLKICI
SSEHHHHHHHCCCCEEE
From residue 141 to 165 type EH
jmol
SSEEEECCCCCCCCHHHHHHHHHHHHHH
Distance7.736088Delta74.371130
Theta158.884663Rho128.517480
Geometrically equivalent Smotifs
PDBChainStartEndTypeDDeltaThetaRho
3f4wA80102EH8.66097467.951411167.051685127.229837jmol
SeqYVTVLGVTDVLTIQSCIRAAKEA
SSEEEEEECCCCHHHHHHHHHHHHHH
3h4tA225EH8.46108579.756998172.342440145.476329jmol
SeqVLITGCGSRGDTEPLVALAARLRE
SSEEEEEEECCHHHHHHHHHHHHHHHH
3v46A126156EH9.00600475.812456162.122163128.668822jmol
SeqVEKVELDKNKRFKDVEVVRYFWHSLEKELIS
SSEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHH
3fwzA3348EH7.87981966.988316158.257385103.210190jmol
SeqLVVIETSRTRVDELRE
SSEEEEEECCHHHHHHHHH
2a9gA356372EH7.45464468.466648150.274858119.722957jmol
SeqVVVGYDRNTYTNTLLRK
SSEEEEEECCCHHHHHHHHH
3f67A170187EH8.27827973.795606151.503013121.565062jmol
SeqVLGLYGAKDASIPQDTVE
SSEEEEEEECCCCCCCHHHHH
3bq9A308334EH8.14996973.179909154.546071103.153034jmol
SeqKIIIDDPAAVAQHMHAGMAAVKQYRRD
SSEEEEECCHHHHHHHHHHHHHHHHHHHHH
1dz3A7896EH6.52308287.383223152.351043135.350885jmol
SeqNVIMLTAFGQEDVTKKAVE
SSEEEEEEEECCCHHHHHHHHH
2fnuA191207EH8.25402764.990419156.279954107.503894jmol
SeqGAVVTNDSELHEKMKLF
SSEEEEEECCHHHHHHHHHH
3w5jA140158EH8.24460179.696499161.805090136.884293jmol
SeqVFQLSTGYQEALQAVTRAL
SSEEEECCCCHHHHHHHHHHHH
2i3dA144167EH7.81948286.231021154.393132136.301666jmol
SeqGLIINGDADKVAPEKDVNGLVEKL
SSEEEEEEECCCCCCCHHHHHHHHHHH
1eziA4561EH8.45118073.576860167.379570115.744877jmol
SeqRIIVSTDGGLIAEEAKN
SSEEEEEEECCHHHHHHHHH
1udxA301324EH8.16659571.040501147.522480140.490064jmol
SeqVLPVSALTGAGLPALKEALHALVR
SSEEEECCCCCCCCHHHHHHHHHHHHH
2yopA6285EH8.08096768.742367153.847791150.792815jmol
SeqVIATKYFDMYEGDNSGPMAKFIQS
SSEEEEEEEECCCCCCCHHHHHHHHHH
1su8A251272EH9.17272672.386656167.088468111.168900jmol
SeqVNVAVHGHNPVLSDIIVSVSKE
SSEEEEEEECCCHHHHHHHHHHHHH
2i0fA6698EH7.53583688.425022152.483837158.696291jmol
SeqGFVALGTVIRGETYHFDIVSNESCRALTDLSVE
SSEEEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHH
1vb3A411424EH7.17628462.730817151.99786699.098034jmol
SeqHNLPADFAALRKLM
SSEEEEECCHHHHHHHH
3q72A5075EH6.49713161.133116161.648263104.540315jmol
SeqAYVIVYSVTDKGSFEKASELRVQLRR
SSEEEEEEEECCCHHHHHHHHHHHHHHHH
1g6hA227243EH6.37174265.652049154.225221106.702891jmol
SeqQIIAEGRGEEEIKNVLS
SSEEEEEEEECHHHHHHHHH
3ix9A96111EH6.57226564.449949150.416713130.716692jmol
SeqLYIVGGKQIFQAFEPY
SSEEEEEECHHHHHHHHHH
2ob0A106124EH6.66076972.510178145.075372146.913550jmol
SeqNIYLHVQISNESAIDFYRK
SSEEEEEEEECCCHHHHHHHHH
2qu8A150193EH8.08504069.973419167.764729123.707346jmol
SeqIKFSSFSTLTGVGVEQAKITACELLKNDQAESILLDQEQLLNTK
SSEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
2a9gA230253EH8.19821678.992106159.580260123.888069jmol
SeqVVLIGMGERSSRQAIGQVAQSLFA
SSEEEEEEECCCCCHHHHHHHHHHHHH
3q72A111137EH8.83039576.116193172.737047106.370637jmol
SeqKFIETSAALHHNVQALFEGVVRQIRLR
SSEEEEECCCCCCCCHHHHHHHHHHHHHHH
2grvA354379EH7.30643967.072563158.405287159.028228jmol
SeqTIVLGVASNDPTSVAVANTAADQLRN
SSEEEEEEEECCCHHHHHHHHHHHHHHHH
4eclA130141EH7.36583764.743112144.110071130.943137jmol
SeqFSTEDKDKILAA
SSEEECCCHHHHHHH
3u4gA644EH7.58439384.856390154.648208122.548855
SeqLFLLVLGNTEISTIPGISVAGATPELTKITPVADAEYLF
SSEEEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
2gn0A179200EH6.44405967.559732151.10626799.955294
SeqNVIVPIGGGGLIAGIAIAIKSI
SSEEEEEECCCCHHHHHHHHHHHHH
2ixsA165183EH8.63777366.406913157.496302108.754762
SeqDEFLLSPAGQNPLLKKMVE
SSEEEEEECCCCCHHHHHHHHH
3e2qA257281EH7.91028874.037074158.115407105.116881
SeqIGFVIQAYQKRCPLVIDYLIDLATR
SSEEEEEEECCCCCHHHHHHHHHHHHHH
1rvv140784111EH7.14173163.733864157.197252150.953900
SeqAIITLGTVIRGATTHYDYVCNEAAKGIAQAANTT
SSEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHH
2gn0A7998EH7.48784564.643311156.497995125.570590
SeqVVACSAGNHAQGVSLSCAML
SSEEEEECCCHHHHHHHHHHHHH
3ceaA525EH8.88380374.406284165.181214131.550205
SeqLRAAIIGLGRLGERHARHLVN
SSEEEEEEECCCCCHHHHHHHHHH
2wvgA6688EH9.18924180.852871163.405980116.757473
SeqAAAVVTYSVGALSAFDAIGGAYA
SSEEEEEECCCCCHHHHHHHHHHHHH
4i4tA6580EH7.63823081.113211144.998218119.459790
SeqAVFVDLEPTVIDEVRT
SSEEEEEECCCHHHHHHHH
2hy5A229EH8.54496567.885024165.596018135.819505
SeqKFALQINEGPYQHQASDSAYQFAKAALE
SSEEEEEEECCCCCCCCHHHHHHHHHHHHHH
3b9oA98123EH9.16016560.576328160.434032124.085706
SeqAFAVTFSTTYEHPYGHARRMSTLDHL
SSEEEEEEEECCCCCHHHHHHHHHHHHHH
1mv8A221EH8.31791080.031238166.785676108.961778
SeqRISIFGLGYVGAVCAGCLSA
SSEEEEEECCCCCHHHHHHHHHH
3cg0A5073EH6.27015363.011042151.697141100.564966
SeqIALVDIMLCGALDGVETAARLAAG
SSEEEEEECCCCCCCCHHHHHHHHHHH
3b1fA727EH8.99675862.705460163.321435112.426409
SeqTIYIAGLGLIGASLALGIKRD
SSEEEEEECCCHHHHHHHHHHHHH
3ty4A186213EH9.17078260.942654167.811422106.532427
SeqLVTIIHKSNVMSVTDGLFRESCRHAQSL
SSEEEEEEECCCCCCCHHHHHHHHHHHHHHH
2hmcA4468EH7.99675866.755731145.939087122.561870
SeqVVYCGSGDWPLLTDEQREGVERLVK
SSEEEECCCCCCCCCCCCCCCHHHHHHH
2qrlA3351EH8.43684476.561321160.323573122.989412
SeqKIYVEDSPQSTFNINEYRQ
SSEEEEEECCCCCCCCHHHHHH
3s2eA169188EH8.23139571.533982166.06720199.859877
SeqWVVISGIGGLGHVAVQYARA
SSEEEEEECCCCCHHHHHHHHHH
3f4wA5575EH8.39757366.344313167.550390131.117571
SeqEVLADAKIMDGGHFESQLLFD
SSEEEEEEEEECCCHHHHHHHHHH
1nsjA99118EH7.56979861.609658161.602442143.478403
SeqLVIKAVGVSNERDMERALNY
SSEEEEEEEEECCHHHHHHHHHH
2as0A213230EH8.22316776.632419164.975751125.497097
SeqRVLDVFTYTGGFAIHAAI
SSEEEEECCCCCCHHHHHHHH
3bzcA386408EH8.28627771.097485165.528502106.869769
SeqLIAIGNGTASRETDKLAGELIKK
SSEEEEEECCCCHHHHHHHHHHHHHH
4edyA323EH8.88229567.987756157.116544149.476478
SeqYKLTYFNMRGRAEIIRYIFAY
SSEEEEEECCCCHHHHHHHHHHHH
1b1cA138165EH6.65422077.854767164.967604110.840645
SeqGLGDDDGNLEEDFITWREQFWPAVCEHF
SSEEEEECCCCHHHHHHHHHHHHHHHHHHHH
3dsdA78100EH8.44159680.195816149.189994145.169640
SeqVFAIEGNSDRTQRGPSVLNLLED
SSEEEEECCCCCCCCCCCCHHHHHHH
2g2cA6383EH9.09723985.900571153.355711101.976440
SeqFIITAGGTGIRAKNQTPEATA
SSEEEEEECCCCCCCCCCHHHHHH
2r6jA625EH8.70673574.654032165.235521130.752299
SeqILIFGGTGYIGNHMVKGSLK
SSEEEEECCCCCCHHHHHHHHHH
3vusA6790EH8.28472380.156052156.16277299.029478
SeqAVVLTFDDGYQSFYTRVFPILQAF
SSEEEEEEEEECCHHHHHHHHHHHHHH
2qrlA194214EH8.71242759.927862158.729806105.382107
SeqVLIIGALGRCGSGAIDLLHKV
SSEEEEECCCCHHHHHHHHHHHHH

Download Data