Frag'R'Us

Parameters

Input pdb2uzi_R.pdb
ChainR
DSSP alphabet3
Secondary structure assignment0   [0: Automatic (DSSP) - 1: User defined]
Minimum helix size5
Mininum beta size2
Scanned DB40
Maximum variation in D (Ang)1.0
Maximum variation in delta (degrees)15
Maximum variation in theta (degrees)15
Maximum variation in rho (degrees)30
Clashes filter active1   [0: off - 1:on]
Tolerance fitting Smotifs (Ang)1.5
Performed task3   [help]

Protein Sequence

1MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTA
60GQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKC
119DLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH

Smotifs

From residue 3 to 25 type EH
jmol
SSEEEEEEEEECCCCCHHHHHHHHHH
Distance7.956150Delta103.674502
Theta144.845974Rho69.693705
Geometrically equivalent Smotifs
PDBChainStartEndTypeDDeltaThetaRho
3a25A114132EH8.33917397.118656151.79480890.703633jmol
SeqLVVDMFAGIGHLSLPIAVY
SSEEEEECCCCCCCCHHHHHHH
5bq5A3452EH7.69614688.838404154.23793858.928842jmol
SeqNILFLGPPGIGKTHLAISI
SSEEEEEECCCCCCHHHHHHHH
1t6nA4162EH8.76420688.844045148.53915164.822096jmol
SeqVLCQAKSGMGKTAVFVLATLQQ
SSEEEEECCCCCCHHHHHHHHHHHH
5hsgA161179EH7.27225089.596927153.88221563.451801jmol
SeqVDGQNVQDKATAAENLITG
SSEEECCCCCCCCCHHHHHHHH
2pjdA293311EH7.64671699.836425133.52001095.627776jmol
SeqLRIVANAFLPYPDVLDETF
SSEEEEEEECCCCHHHHHHHHH
1um8A7191EH7.78329889.677743135.87163366.505665jmol
SeqILLIGPTGSGKTLMAQTLAKH
SSEEEEECCCCCCHHHHHHHHHHH
4aurA5070EH8.08001099.959359152.03796344.024068jmol
SeqLRIALLGAFSDGKTSVIAAWL
SSEEEEEEEECCCCCHHHHHHHHH
2fnaA3153EH7.924688105.939868140.44805552.479849jmol
SeqITLVLGLRRTGKSSIIKIGINEL
SSEEEEEEECCCCCHHHHHHHHHHHH
1in4A3859EH7.98010693.119778150.74065840.472121jmol
SeqVLLAGPPGLGKTTLAHIIASEL
SSEEEEECCCCCCHHHHHHHHHHHH
3io5A2450EH8.165978108.925079150.96261173.659677jmol
SeqGLLILAGPSKSFKSNFGLTMVSSYMRQ
SSEEEEEEEECCCCCHHHHHHHHHHHHHHH
2uz1A94124EH8.357677101.025646147.41459893.154466jmol
SeqVLFLTGSGALRDDETNTLQAGIDQVAMAAPI
SSEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHH
3tm0A3966EH7.14553799.090946132.22043489.842939jmol
SeqNLYLKMTDSRYKGTTYDVEREKDMMLWL
SSEEEEEEEECCCCCCCCCCHHHHHHHHHHH
3h2yA107122EH7.509816111.557138135.44669795.621799jmol
SeqVYVVGCTNVGKSTFIN
SSEEEEEEECCCCHHHHHH
3nwnA8399EH8.088767109.784536154.42520950.775099jmol
SeqGTIMCYGQTGAGKTYTM
SSEEEEEEEECCCCCHHHHH
4cmrA4364EH8.867989117.847580146.84050289.990628jmol
SeqEEVKGRNWTRAIKAYEYVDETL
SSEEEEEECCCCCCCHHHHHHHHHH
2oap1247263EH7.541851114.593994143.50772141.907066jmol
SeqAIVVGETASGKTTTLNA
SSEEEEEECCCCCHHHHHHH
3ch4B1235EH7.59418798.603932151.56371383.797028jmol
SeqLVLLFSGKRKSGKDFVTEALQSRL
SSEEEEEEEECCCCCHHHHHHHHHHHH
2c61A123141EH8.332579101.915756156.32004776.288444jmol
SeqIFSASGLPHNEIALQIARQ
SSEEEECCCCCHHHHHHHHHHH
4rkeA932EH8.222979104.753016143.93222663.908331jmol
SeqYLFKYIIIGDTGVGKSCLLLQFTD
SSEEEEEEEEEECCCCCHHHHHHHHHH
1jsxA5674EH8.836790106.460107149.21209372.233648jmol
SeqRFIDVGTGPGLPGIPLSIV
SSEEEEEECCCCCCCHHHHHHH
2hf9A2447EH8.369142107.552159145.79040953.418649jmol
SeqVAFDFMGAIGSGKTLLIEKLIDNL
SSEEEEEEEECCCCCHHHHHHHHHHHH
5c78A378395EH8.469095106.359945145.58883451.711222jmol
SeqIAFIGESGCGKSTLVDLI
SSEEEEEECCCCCHHHHHHHH
2pcjA3149EH7.905328102.924205142.29321767.804604jmol
SeqFVSIIGASGSGKSTLLYIL
SSEEEEEEECCCCCHHHHHHHH
3hbfA109125EH8.779242115.778040153.07072360.102047jmol
SeqCLVTDAFFWFGADLAEE
SSEEEEEECCCCCHHHHHHH
3u7qB917934EH7.76812293.655959151.78097095.627375jmol
SeqFMIGNSYGKFIQRDTLHK
SSEEEEECCCHHHHHHHHHHH
4yo7A3558EH8.36245597.167778149.01393269.025797jmol
SeqFEFIFSDAQNDSTQQAQVENFISR
SSEEEEEEEECCCCCCCCCHHHHHHHH
1j6uA355373EH7.87900691.149543145.29872893.951358jmol
SeqEVVVTEVYDSGKIWDSLKS
SSEEEEECCCCCCCCCHHHHHH
1cr1A3761EH7.99893699.405762146.37044467.006161jmol
SeqVIMVTSGSGMGKSTFVRQQALQWGT
SSEEEEEEECCCCCHHHHHHHHHHHHHH
3mwbA191214EH7.324961100.577630140.88403071.958343jmol
SeqDKTTVVVPLPEDHPGALEILDQFA
SSEEEEEEEEECCCCCCCCCCHHHHHH
2qt1A929EH8.252580105.156273153.89192447.131150jmol
SeqFIIGISGVTNSGKTTLAKNLQ
SSEEEEEEEECCCCCHHHHHHHHH
4v03A3346EH7.89694491.305685130.45820977.819377jmol
SeqVLLIDADRNLDMIL
SSEEEEEECCCCHHHHH
4yj1A253275EH7.710792102.697579143.62113983.204035jmol
SeqLTLIAGGGFHGKSTLLRALEVGI
SSEEEEEEECCCCCHHHHHHHHHHHH
4r7yA331349EH8.715026105.751894150.15570374.635203jmol
SeqVLLVGDPGVAKSQILRYVA
SSEEEEEECCCCCHHHHHHHHH
4pscA5282EH8.10127595.465954154.16375043.773284jmol
SeqVTVLFARGTCDPGNVGVLVGPWFFDSLQTAL
SSEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHH
5c1tA218EH7.90982690.171930132.94327872.982473jmol
SeqRLLVVGSSGVGKTTLCD
SSEEEEEECCCCCCHHHHHH
1pujA113133EH8.268637101.813221150.38276967.994475jmol
SeqIRALIIGIPNVGKSTLINRLA
SSEEEEEEEECCCCCHHHHHHHHH
2cxxA221EH8.267282115.339653144.70354479.057651jmol
SeqTIIFAGRSNVGKSTLIYRLT
SSEEEEEEEECCCCHHHHHHHHH
2raaA320EH7.86987391.953349155.76363448.508923jmol
SeqYFEIRWHGRAGQGAKSAS
SSEEEEEEEECCCCCCHHHHH
1g41A5272EH8.70912991.823211141.32098859.008524jmol
SeqILMIGPTGVGKTEIARRLAKL
SSEEEEECCCCCCHHHHHHHHHHH
4bloA113131EH8.926598107.382681132.81421452.191128jmol
SeqGVTALMGATGSGKSITLNE
SSEEEEEEEECCCCCHHHHHHH
4tmxA1130EH8.013089102.527472137.33214570.887837jmol
SeqICCILGHVNTGKTKLLDKIR
SSEEEEEEECCCCCHHHHHHHHH
3czqA7592EH8.605273115.382770154.37966451.457141jmol
SeqVFEGRDAAGKGGAIHATT
SSEEEEECCCCCHHHHHHHHH
3t5gA327EH7.755904104.103198145.94170857.517401jmol
SeqSKSRKIAILGYRSVGKSSLTIQFVE
SSEEEEEEEEEEECCCCCHHHHHHHHHH
2bwjA1133EH8.11950994.594326151.17158457.336167jmol
SeqIIFIIGGPGSGKGTQCEKLVEKY
SSEEEEEEECCCCCHHHHHHHHHHHH
1wvhA106131EH7.85114496.400477133.57003440.141033jmol
SeqNVCHLFAELDPDQPAAAIVNFVSRVM
SSEEEEEEEEECCCCCCHHHHHHHHHHHH
2jdiA143162EH8.141471114.842416150.76425771.181805jmol
SeqLIIGDRQTGKTSIAIDTIIN
SSEEEEECCCCCHHHHHHHHHHH
5d3qA2948EH8.399111115.589454132.58314592.363323jmol
SeqQIAVVGGQSAGKSSVLENFV
SSEEEEEEEECCCCHHHHHHHHH
3rhtA219EH8.21432590.038933152.57751563.746174jmol
SeqVLYCGDTSLETAAGYLAG
SSEEEEEECCCCCCCHHHHHH
1e9rA5376EH8.716774103.634852155.13566371.996471jmol
SeqLLVNGATGTGKSVLLRELAYTGLL
SSEEEEEECCCCCHHHHHHHHHHHHHH
4ne2A77100EH7.950740108.618399150.42020539.936040jmol
SeqYIISIAGSVAVGKSTTARVLQALL
SSEEEEEEEECCCCCHHHHHHHHHHHH
2rhmA528EH7.406122101.056612154.27977060.518128jmol
SeqALIIVTGHPATGKTTLSQALATGL
SSEEEEEEEECCCCCHHHHHHHHHHHH
2gcuA5376EH7.94074289.477336154.46793962.835806jmol
SeqKLIYAMNTHVHADHVTGTGLLKTK
SSEEEEEEECCCCCCCCCCCHHHHHHH
2hoqA170186EH7.770899107.911018157.65959982.328376jmol
SeqALMVGDRLYSDIYGAKR
SSEEEEEECCCCCCHHHHHH
4oi4A108130EH8.146217109.192521148.84642247.978686jmol
SeqRVVIVGGSQTGKTSLSRTLCSYA
SSEEEEEEECCCCCHHHHHHHHHHHH
3gj0A1027EH8.301119103.640319144.23356149.706344jmol
SeqQFKLVLVGDGGTGKTTFV
SSEEEEEEEEECCCCCHHHHH
4r0vA154166EH8.74463898.876525141.14260845.658675jmol
SeqVSIMPCTRKQSEA
SSEEEEECCCCHHHHH
3evnA223EH8.014210105.947747156.74762480.286280jmol
SeqVRYGVVSTAKVAPRFIEGVRLA
SSEEEEEEEECCCCHHHHHHHHHHH
3oy2A218243EH8.59883594.004254133.87476969.866305jmol
SeqVRFLCNSHHESKFDLHSIALRELVAS
SSEEEEEEECCCCCCCCHHHHHHHHHHHH
2zpaA178200EH8.345882104.452208142.93949664.502594jmol
SeqGVAAVTAARGRGKSALAGQLISR
SSEEEEEEEECCCCCHHHHHHHHHHH
4ydsA2246EH8.162750101.910843152.08700965.272895jmol
SeqSIMIEGDHGTGKSVLSAQFVLGFLL
SSEEEEEEECCCCCHHHHHHHHHHHHHH
4a1fA4872EH8.79663791.636733148.93010863.978781jmol
SeqLVIIGARPSMGKTSLMMNMVLSALN
SSEEEEEEECCCCCHHHHHHHHHHHHHH
2f6rA3254EH8.65915899.963799154.14378751.807547jmol
SeqYVLGLTGISGSGKSSVAQRLKNL
SSEEEEEEEECCCCCHHHHHHHHHHH
3a27A6987EH8.75606091.244183151.83020362.657279jmol
SeqVVVDMFAGIGYFTIPLAKY
SSEEEEECCCCCCCCHHHHHHH
4x6gA94117EH6.97505793.830413142.74442147.167586jmol
SeqLKVGAIYTIGPYLFPHLIPQLHRV
SSEEEEEEECCCHHHHHHHHHHHHHHH
3nbxX3960EH8.30929192.437008147.53894960.632265jmol
SeqSVFLLGPPGIAKSLIARRLKFA
SSEEEEEECCCCCCHHHHHHHHHHH
3defA3152EH8.482464107.293667154.14984061.067587jmol
SeqSMTVLVLGKGGVGKSSTVNSLI
SSEEEEEEEEECCCCCHHHHHHHHH
4hziA3149EH8.80327191.614637140.03333562.973225jmol
SeqHCVLLGRNGAGKSTLVNLI
SSEEEEEEECCCCCHHHHHHHH
1sviA2544EH7.858312115.270929139.99312375.449635jmol
SeqEIALAGRSNVGKSSFINSLI
SSEEEEEEEECCCCHHHHHHHHH
3fvqA3150EH8.248047101.228669137.59646975.454785jmol
SeqILFIIGASGCGKTTLLRCLA
SSEEEEEEECCCCCHHHHHHHHH
3pqcA2443EH8.581712117.377475143.51519770.075683jmol
SeqEVAFVGRSNVGKSSLLNALF
SSEEEEEEEECCCCHHHHHHHHH
3ln6A498510EH8.411456103.213618156.43184981.637017jmol
SeqFTDRKEALNYFSQ
SSEEECCCCHHHHHHH
3ge3E890911EH7.42535193.590531152.98472097.878159jmol
SeqNVGPIIRAGDLVEPVIETAEID
SSEEEEEEEECCCCHHHHHHHHHHH
1r5bA168204EH8.20699693.898647140.55308774.646336jmol
SeqVKYMPVSAYTGQNVKDRVDSSVCPWYQGPSLLEYLDS
SSEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
3fzgA143172EH8.723922100.211113143.87156251.940072jmol
SeqHTQNFVISFPIKSLSEKGMEENYQLWFESF
SSEEEEEEEEEEECCCCCCCCCCCCHHHHHHHH
2p62A89109EH7.240854115.801461133.90712239.639299jmol
SeqVEEVYVVRDVDEGNDVFEWVL
SSEEEEEEEEEECCCCCCHHHHHH
1texA526EH8.24403298.783614157.04941895.820730jmol
SeqAYLVLASQRSGSTLLVESLRAT
SSEEEEEEECCCCCHHHHHHHHHHH
2x4dA210226EH7.849180108.399664156.40072861.518770jmol
SeqAVMIGDDIVGDVGGAQR
SSEEEEEECCCCCCHHHHHH
5dyhA248272EH8.531673103.172341151.34212261.002236jmol
SeqTVVARSMGGKEDLIWELLNQAQEHF
SSEEEEEECCCCCHHHHHHHHHHHHHHH
1y44A85103EH7.69021589.126855131.05716251.282305jmol
SeqLTVYGPKGIKAFIETSLAV
SSEEEEEECCCHHHHHHHHHHH
3louA326EH7.519591112.048226139.79643746.632136jmol
SeqQFVLTLSCPSAAGQVAAVVGLLDR
SSEEEEEEEEEECCCCHHHHHHHHHHH
4lj9A7296EH8.82835991.233583146.09021557.302510jmol
SeqGSFLFLGPTGVGKTELAKTLAATLF
SSEEEEEEECCCCCCHHHHHHHHHHHHH
4mkiA320338EH8.46726298.686750140.38833964.809059jmol
SeqFVGIIGHTGSGKSTLIQQL
SSEEEEEEECCCCCHHHHHHHH
1f60A530EH7.58835497.011034151.66873674.925470jmol
SeqSHINVVVIGHVDSGKSTTTGHLIYKC
SSEEEEEEEEEECCCCCHHHHHHHHHHHH
1puiA1733EH8.09159899.554545144.23962551.095674jmol
SeqIEVAFAGRSNAGKSSAL
SSEEEEEEEECCCCCHHHHH
4gfrA6495EH8.78719691.450902133.75512642.548024jmol
SeqSVTFDIRKGVKWSDGEAFTADDVVYSFGLLKA
SSEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHH
5a0yC10661092EH8.377991103.811358139.75569639.836244jmol
SeqVRYIQFTDSMYFAPAQPYVRSRAYLCR
SSEEEEEEEEECCCCCCCCHHHHHHHHHHH
4gs1A315341EH8.794080107.357662131.23830367.016026jmol
SeqRDAGLLFMAWQGNPATGFVPVQRSLVE
SSEEEEEEEEEEEECCCCCCHHHHHHHHHH
1dbwA4971EH8.32025794.422726144.03544752.945160jmol
SeqGVLVTDLRMPDMSGVELLRNLGD
SSEEEEEEECCCCCCCHHHHHHHHHH
4a27A189204EH7.77717791.102392152.30995944.769462jmol
SeqHLFDRNADYVQEVKRI
SSEEEEECCCCHHHHHHHH
1wxqA220EH7.31027497.230086155.79065473.210300jmol
SeqIGVVGKPNVGKSTFFSAAT
SSEEEEEECCCCCHHHHHHHHH
3q72A422EH8.428676104.990962146.73668257.822667jmol
SeqKVLLLGAPGVGKSALARIF
SSEEEEEEECCCCCHHHHHHHH
1nd4A3862EH8.621255104.302739140.18897083.853399jmol
SeqLFVKTDLSGALNELQDEAARLSWLA
SSEEEEEEECCCCCCCHHHHHHHHHHHH
4fidA724EH7.78855097.420256142.90171285.269826jmol
SeqLGSGESGKSTIAKQLKIL
SSEEECCCCCHHHHHHHHHHH
1xg8A842EH7.61765692.231236159.56744051.877028jmol
SeqNAVVVYGADVICASCVNAPTSKDIYDWLQPLLKRK
SSEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHH
3czpA264285EH8.721915107.676717156.34124961.642316jmol
SeqSLVAVFEGNDAAGKGGAIRRVT
SSEEEEEEEEECCCCCHHHHHHHHH
2ce2X325EH8.065260104.785647147.71978065.340219jmol
SeqEYKLVVVGAGGVGKSALTIQLIQ
SSEEEEEEEEECCCCCHHHHHHHHHH
3vkgA530551EH7.58845790.799704143.04749348.408192jmol
SeqGGNPFGPAGTGKTETVKALGSQ
SSEEEEEECCCCCCHHHHHHHHHHH
3on3A219EH7.876435114.539086154.74369968.863591jmol
SeqYEIRFSGAGGQGLILAGV
SSEEEEEEEECCCCCHHHHHH
1qf9A730EH8.319823105.207067147.09957646.950004jmol
SeqNVVFVLGGPGSGKGTQCANIVRDF
SSEEEEEEEECCCCCHHHHHHHHHHHH
3ga7A142163EH7.219614105.886252144.78990786.483092jmol
SeqKIGFAGDAGALALASALWLRDK
SSEEEEEEECCCCCHHHHHHHHHHH
1w4rA328EH8.018593104.482878152.76559361.471531jmol
SeqQIQVILGPMFSGKSTELMRRVRRFQI
SSEEEEEEEECCCCCHHHHHHHHHHHHHH
3lkdA208225EH8.726958108.516567148.37560841.801446jmol
SeqTLYDATGSGSLLLNAKRY
SSEEEEECCCCCCCHHHHHHH
2xedA829EH7.269562115.662710137.62852686.211634jmol
SeqRRIGLVVPSSNVTVETEMPALL
SSEEEEEEEEECCCCCHHHHHHHHH
2fp4B656674EH7.27979799.174854156.09466679.062655jmol
SeqLVVRLEGTNVHEAQNILTN
SSEEEEEEEECCHHHHHHHHHH
2jdiD15971619EH7.723088104.628274144.62442856.798311jmol
SeqKIGLFGGAGVGKTVLIMELINNV
SSEEEEEEECCCCCHHHHHHHHHHHH
2iksA3556EH7.84762195.227243145.51076044.787351jmol
SeqQLLIACSEDQPDNERCIEHLLQ
SSEEEEEEECCCCCCCCCHHHHHHH
3g89A7290EH8.656457105.675513143.41560376.762215jmol
SeqRVLDLGTGAGFPGLPLKIV
SSEEEEEECCCCCCCHHHHHHH
1hr6B768798EH7.245579110.404117150.00691854.054190jmol
SeqGLWGMYIVTDSNEHNVRLIVNEILKEWKRIK
SSEEEEEEEEEEECCCCCHHHHHHHHHHHHHHHH
2qgzA5580EH7.23770188.866120148.24143574.460191jmol
SeqGLYLYGDMGIGKSYLLAAMAHELSEK
SSEEEEEECCCCCCHHHHHHHHHHHHHHH
1zghA113137EH7.758456106.350975146.49991659.379008jmol
SeqIFFKRDLDLYGTAEEIFRASKIIFN
SSEEEEEEEEECCCCCCCCCCHHHHHHH
4tl6A2753EH8.458074100.773715149.08528272.304511jmol
SeqSTLVSGTSGTGKTLFSIQFLYNGIIEF
SSEEEEEEECCCCCHHHHHHHHHHHHHHHH
4ceiB11721197EH8.099513100.101940137.34448965.583422jmol
SeqAEFLVGRSGSGKTKLIINSIQDELRR
SSEEEEEEECCCCCHHHHHHHHHHHHHHH
3hoiA112151EH8.707146106.770452155.91095548.943730jmol
SeqVSLVLVSDLSKLGDAKSNHVQLGADAGIVSQNISLFCSAA
SSEEEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
5fotA2547EH8.376592108.810313143.99105771.783562jmol
SeqAITEVFGEFGSGKTQLAHTLAVM
SSEEEEEEEECCCCCHHHHHHHHHHH
4finA3248EH7.443216101.806192133.01734381.111336jmol
SeqKIGVLGLNGAGKSTLLR
SSEEEEEEECCCCCHHHHHH
1u7lA632EH8.34016998.372917137.38168565.484019jmol
SeqDFILISLPQNAQPVTAPGSKTDSWFNE
SSEEEEEEEEECCCCCCCCCCCCHHHHHHH
5ca8A3253EH8.684667105.385715152.44466749.764637jmol
SeqYHIISVFGSQSTGKSTLLNRLF
SSEEEEEEEEECCCCCHHHHHHHHH
1ko7A145166EH8.543041104.610632150.56956257.265029jmol
SeqVGVLITGDSGIGKSETALELIK
SSEEEEEEEECCCCCHHHHHHHHHH
2ihtA91118EH8.483734106.450110143.30393272.455549jmol
SeqVIALAAQSESHDIFPNDTHQCLDSVAIV
SSEEEEEEEECCCCCCCCCCCCCCCCHHHHH
3nutA7397EH8.470539101.277704138.89683079.247879jmol
SeqRVVVVSSGDPGVFAMASALFEALEA
SSEEEEEEECCCCCCCCHHHHHHHHHHH
3lmaA7595EH7.647677118.171811148.76013553.085211jmol
SeqIFLAGDLLNQNVTANYVARHL
SSEEEEEEECCCCCCCHHHHHHHH
1c96A159173EH7.24856394.347140150.64560044.555632jmol
SeqLLIGTDSHTPNGGGL
SSEEEEECCCCHHHHHHH
1xahA1328EH7.09489297.862999145.54945178.546454jmol
SeqPIYVEHGAIKYIGTYL
SSEEEEEECCHHHHHHHHH
4zkdA207246EH8.661171100.456524147.52317096.508407jmol
SeqFQFIPCSGLLGSNLNKINYVPEWYEGPTFFSQLYLLVEHN
SSEEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
4blqA93119EH7.50515797.861811141.96079252.030951jmol
SeqGAELIISGTAGGKTVLTNHYAAQMCAK
SSEEEEEEEECCCCCHHHHHHHHHHHHHHH
2bmoA398420EH7.828099101.820893150.83785766.865943jmol
SeqVVGKSAIGETSYRGFYRAYQAHI
SSEEEECCCCCCHHHHHHHHHHHHHH
5bxaA178196EH8.863678105.318511130.10805993.451163jmol
SeqMAFFSEMPDGRTMFDALGH
SSEEECCCCCCCCCCHHHHHHH
1ygrA497523EH7.747746102.708705147.37978860.561976jmol
SeqLLIHCRDGSQQTGIFCALLNLLESAET
SSEEEEEECCCCCCHHHHHHHHHHHHHHHH
3frhA200217EH8.33559399.436013140.12009153.959132jmol
SeqRMAVSFPTRNYAAWFEGG
SSEEEEEEEECCCHHHHHHHH
4lyaA318338EH8.054047104.632063153.17167449.984336jmol
SeqCLIVGQSRKGKTNVVKVILES
SSEEEEEECCCCCHHHHHHHHHHH
3vayA175191EH7.912457106.804464158.13416860.309947
SeqAVHVGDHPSDDIAGAQQ
SSEEEEEECCCCCCHHHHHH
3agkA196213EH8.09533089.098750149.52045582.068779
SeqLKGVIVAGPGLAKQEFVE
SSEEEEEEEEECCCHHHHHHH
3outA621EH8.898109106.934184154.47953242.798762
SeqIGVFDSGIGGLTIVKN
SSEEEEEECCCCCHHHHHH
2om6A172188EH7.458183105.671412155.61023275.228771
SeqSLHIGDTYAEDYQGARK
SSEEEEEECCCCCCHHHHHH
4c1lA161190EH8.69324389.634018144.65127144.791981
SeqVILCERGIRTFETATRFTLDDSAVPVVKEL
SSEEEEEECCCCCCCCCCCCCCCCCHHHHHHHH
2rdxA4677EH8.852460100.079495143.72485978.259350
SeqQGCGEFTPCGENYMIAHSEGVDAFARLAAPQL
SSEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHH
3ptwA268285EH8.11685896.820246157.88342861.532599
SeqTFIEIGPGKALSGFVKKI
SSEEEEEECCCCHHHHHHHHH
1toaA163178EH8.87191091.807447139.37908889.002117
SeqVLVTAHDAFGYFSRAY
SSEEEEEEECCCHHHHHHH
4zcfA415436EH7.52766489.282268157.00077180.258707
SeqEGIVLDFFAGSGTTAHTVFNLN
SSEEEEEEECCCCCCHHHHHHHHHH
5egpA4462EH8.49583589.254111152.08992365.340784
SeqVVLDNACGIGAVSSVLNHT
SSEEEEEECCCCCHHHHHHHHH
4zocA300316EH8.938897104.372300137.04314776.134053
SeqLEMMTTCYIHELKGLIE
SSEEEECCCHHHHHHHHHHH
5cvdA7286EH8.60734091.302349148.43594369.345609
SeqCALDCGAGIGRITKR
SSEEEEEECCCCCHHHHH
4ygsA161177EH7.931328107.529384157.08492760.862304
SeqAVMVGDSLSQDVYGAKS
SSEEEEEECCCCCCHHHHHH
2a9sA2641EH7.926643105.368937157.05948672.828376
SeqVSTAESCTGGLIAGAL
SSEEEEEECCCCCHHHHHH
4w82A183196EH7.08903091.045720153.30024271.559776
SeqFANSRSFEQHVLWH
SSEEEECCCHHHHHHHH
4r6yA433EH8.72762297.598900157.36450367.857628
SeqSVVTVYSIDGLHDGDNSWYQVQFDAFTKAT
SSEEEEEEEEECCCCCCCCCHHHHHHHHHHHHH
3kzwA385405EH7.62263390.286863159.37188166.058417
SeqAAAFESNSKVILNDILQISSE
SSEEEEEEECCHHHHHHHHHHHHH
1tuoA173192EH8.895410103.849874134.50933399.591537
SeqLYHDSMGGAGAGFLKGFLRH
SSEEEEECCCCCCCCHHHHHHHH
4ewcA330347EH8.36594097.650076133.37417753.797996
SeqKVGVNSTFTSVARTCVAV
SSEEEEECCCCCCHHHHHHHH
4zoeA300316EH8.910855104.118972137.88209076.761934
SeqLEMMTTCYIHELKGLIE
SSEEEECCCHHHHHHHHHHH
3qatA271290EH7.93196593.479509156.37662165.244313
SeqVNTLFEIGSGKVLTGLARRI
SSEEEEEEEECCCCHHHHHHHHH
2gliA150163EH8.678179102.615049144.78967141.263020
SeqAFSNASDRAKHQNR
SSEEECCCCCCHHHHHH
3gu3A2539EH8.73011096.680691143.00602761.070372
SeqHIVDYGCGYGYLGLV
SSEEEEEECCCCCHHHHH
4c4aA371387EH7.664312106.334920152.73148085.952566
SeqVCLCVSDGSLLSMLAHH
SSEEEEEECCCCCHHHHHHH
3ib6A115131EH8.138379109.309346156.73431280.543351
SeqAVMVGNTFESDIIGANR
SSEEEEEECCCCCCHHHHHH
1tz9A297332EH8.39647794.998064135.18436247.756369
SeqIRPDHGRAIWDEKAPGYGLYDRAGLTYIQGLYEATK
SSEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
2vpiA524EH8.590451104.407185156.04422344.241454
SeqVVILDAGAQYGKVIDRRVRE
SSEEEEEECCCCCCHHHHHHHHH
4uuwA264279EH7.41650596.739144154.01404465.032507
SeqLSTMESLTGGLLGAEI
SSEEEEEECCCCCHHHHHH
2ip2A166184EH8.94481395.513871158.17542077.009130
SeqSFVDVGGGSGELTKAILQA
SSEEEEEECCCCCHHHHHHHHH
2dyoA3560EH6.97413692.182078154.54733191.963187
SeqVLRIRVPRETYLVNYMPLIWNKIKSF
SSEEEEEEEECCCCHHHHHHHHHHHHHHH
2oyrA422EH8.30653392.746655152.28845439.936700
SeqLIDETGAGDGALSVLAARW
SSEEEECCCCCCCHHHHHHHHH
1gppA109138EH8.08806298.072839155.95459168.292828
SeqIVELVKEVSKSYPVSEGPERANELVESYRK
SSEEEEEEEEEEEEEECCCCCHHHHHHHHHHHH
2yc2C379410EH8.356608116.233653150.89325584.219881
SeqDFFDVSADAPFLSIATTFYRNYEDKVAAFQDA
SSEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHH
3uhfA1029EH8.50458099.219462156.01525071.999524
SeqKIGVFDSGVGGLSVLKSLYE
SSEEEEEEECCCCCHHHHHHHHH
4bgpA67104EH8.12640394.668011146.31960885.407266
SeqVINNHFPGNRNNPIGNNDLTIHRLSGYLARWVLDQYNE
SSEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
1wqaA176197EH8.122798100.805590155.07048768.142179
SeqFVVVDTSNGAGSLTLPYLLREL
SSEEEEEECCCCCCCCCHHHHHHHH
1nv8A113131EH7.89448894.470430158.35444795.114383
SeqTVADIGTGSGAIGVSVAKF
SSEEEEEECCCCCHHHHHHHHH
3odhA230EH7.678504105.177832150.61053081.204229
SeqKIKRIEVLINNGSVPGIPMILNEIQDAIK
SSEEEEEEEEEEEECCCCCHHHHHHHHHHHHH
4yweA166189EH8.25967595.204527154.46292193.418014
SeqACVVKPAEDACLSVLRVAELAAEA
SSEEEEEEEECCCCHHHHHHHHHHHHH
3gohA264280EH8.17015899.805030156.081875100.067214
SeqDIFRFEQIEALDHSEQT
SSEEEEECCCCHHHHHHHHH
3ibwA626EH7.68472096.451201139.58585262.110598
SeqGIRIVGEDKNGTNQITGVISK
SSEEEEEEEECCCCCHHHHHHHHH
2plwA2342EH8.79772292.306900158.67760546.822020
SeqKIILDIGCYPGSWCQVILER
SSEEEEEEECCCCCHHHHHHHHH
2b94A6285EH8.92596592.202098149.54910639.194296
SeqQKFLCVSHGVGSAGCAICFEELMN
SSEEEEEEEEECCCCCCCHHHHHHHHH
4wqmA255288EH8.198243104.482040143.11933839.567019
SeqLKLINVSSSVVGNSESSYPTGYVHEIIPEYMEGL
SSEEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHH
3vk5A99124EH8.142835105.765720144.28284296.441788
SeqALLLPALLGSGDDYFVWKSFLETLAA
SSEEEEEEEECCCCCCCCCCHHHHHHHHH
2qi2A166184EH7.05188692.086074155.81178571.670439
SeqIIILGPGFARDRFARYCAQ
SSEEEEEECCCHHHHHHHHHHH
4cl2A159174EH8.413745106.128949138.38253088.218503
SeqWFVTSEGCLVYLAEDF
SSEEEEEEECCCHHHHHHH
4dcmA4053EH8.77277290.188098157.087554100.626999
SeqVLILNDAFGALSCA
SSEEEEECCCCCHHHHH
3gy9A7595EH8.40056388.927983151.39526541.062712
SeqRHVYVLPEARSHGIGTALLEK
SSEEEEEECCCCCCCCHHHHHHHH
2ih2A2241EH8.045160104.037919151.51149462.014406
SeqRVLEPACAHGPFLRAFREAH
SSEEEEEECCCCCHHHHHHHHHH
1xtpA87101EH8.44046094.946171144.37950081.990856
SeqRALDCGAGIGRITKN
SSEEEEEECCCCCHHHHH
3m33A125149EH7.678644108.352851147.03752973.167768
SeqAAPDAHFLYVGPRLNVPEVPERLAA
SSEEEEEEEEEEEECCCCCCHHHHHHHH
1kl7A264283EH7.90664689.914760159.48178199.625677
SeqVKFVVPSGNFGDILAGYFAK
SSEEEEEEECCCCHHHHHHHHHH
2bpoA590615EH8.314083100.853921153.66993249.148376
SeqFIYVCGDAKGMAKGVSTALVGILSRG
SSEEEEEEECCCCHHHHHHHHHHHHHHHH
1chmA7489EH7.237197104.885278151.04706182.126042
SeqVISISANIDGGQPWRR
SSEEEEEEECCCCCHHHHH
2w8tA249263EH7.54408589.892660139.88150382.916569
SeqGFVVSNHPKFEAVRL
SSEEEEEECCCCHHHHHH
3rtlA1228EH7.626824112.707856156.36944967.025828
SeqYVVYESVENNESMMDTF
SSEEEEEECCCCCCCHHHHH
4onqA225243EH7.857973101.621026143.98581587.412200
SeqINVLSLFSGIGGGEVALYR
SSEEEEEEECCCCCHHHHHHHH
1oboA82111EH7.526400112.196566159.23168745.321679
SeqLVAYFGTGDQIGYADNFQDAIGILEEKISQ
SSEEEEEEEECCCCCCCCCCCHHHHHHHHHHHH
3im9A275294EH8.117795100.305167156.59235070.480372
SeqVDHFIEIGPGKVLSGLIKKI
SSEEEEEEEECCCCHHHHHHHHH
2h1yA268283EH8.33557493.833425157.85212086.074200
SeqIFFELGCGSVLKGLNK
SSEEEEEECCCCHHHHHHH
3d2mA375388EH7.41794391.999954156.80157895.277729
SeqRLFALSTNTGEWFA
SSEEEEEEECCCHHHHH
2rjoA193212EH8.50977093.738695149.08604470.544953
SeqIKGVWAANDDALGAIEALRA
SSEEEEEEECCCCCHHHHHHHHH
2h00A6484EH8.21738799.923453155.69210979.013197
SeqRGIDIGTGASCIYPLLGATLN
SSEEEEEECCCCCCHHHHHHHHHH
4ts5A3352EH6.958453112.560992158.59916599.941658
SeqVIVAIARGGLVPARLVADVL
SSEEEEEEECCCHHHHHHHHHHH
2dwuA525EH8.944190102.355649158.53931571.289248
SeqVIGVLDSGVGGLTVASEIIRQ
SSEEEEEEECCCCCHHHHHHHHHH
2og9A3864EH7.949146106.460734148.53666539.361222
SeqQGLGFSYSKRAGGPGQFAHAREIAPAL
SSEEEEEEEEEECCCHHHHHHHHHHHHHHH
4yleA191208EH8.76884293.104315159.81380261.861853
SeqALLCGNDNAIGAVSAVRA
SSEEEEECCCCCHHHHHHHHH
1qd1A122141EH8.516541107.808426159.44214265.756882
SeqVYLYGEAARTAGRQSLPALR
SSEEEEEECCCCCCCCCCHHHHH
1ddgA323347EH8.29952293.223481156.41051863.253980
SeqHIYVCGDANRMAKDVEQALLEVIAE
SSEEEEEEECCCCHHHHHHHHHHHHHHH
1piiA83106EH7.91446293.194534154.86581053.202891
SeqAISVLTDEKYFQGSFNFLPIVSQI
SSEEEEEECCCCCCCCCCCHHHHHHHH
4yj6A169186EH8.935904108.234622138.19161086.695517
SeqVAGGTDGGGSIRIPAAWT
SSEEEEEEECCCCCCHHHHHH
3c19A1133EH7.77532692.071619147.85838580.338253
SeqLMFLVTVLDDRDGEVLGDAIQKL
SSEEEEEEEEEECCCCCHHHHHHHHH
3qk7A3758EH7.355804100.958470140.78932293.072023
SeqDLLLIPDEPGEKYQSLIHLVET
SSEEEEEEEECCCCCCHHHHHHHHH
3qv2A422EH7.27108389.950587137.90930371.304616
SeqVNVIEFFSGIGGLRSSYER
SSEEEEEEECCCCCHHHHHHHH
5ifzA4965EH7.00756692.083319144.63327342.039261
SeqRAILVCGTGIGVCIAAN
SSEEEEEEECCCHHHHHHHH
2g5cA220EH8.64641490.571510155.36552292.367479
SeqNVLIVGVGFGGSFAKSLRR
SSEEEEEECCCCCHHHHHHHHH
1g55A322EH8.34515195.636278149.12311552.727469
SeqLRVLELYSGVGGMHHALRES
SSEEEEEEECCCCCHHHHHHHHH
1nijA294313EH7.391713104.702479139.37546654.109733
SeqSTMVFIGIQLPEEEIRAAFA
SSEEEEEEEEECCCHHHHHHHHH
1dcfA5376EH8.17447389.567936146.35086170.253792
SeqVVFMDVCMPGVENYQIALRIHEKF
SSEEEEEECCCCCCCCCHHHHHHHHHH
5bp1A129152EH8.872077112.868218149.36480644.434629
SeqAITVDTACSSSLSAIHMACRSLHD
SSEEEEEECCCCCCCHHHHHHHHHHHH
4obxA4265EH7.86365793.316343151.81420753.573788
SeqNFIDVAGGSGDIAFGLLDHAESKF
SSEEEEEECCCCCHHHHHHHHHHHHHH
4o5aA170188EH8.55761890.775768146.70683165.847080
SeqAIIYDNDVALAGESVASVK
SSEEEEECCCCCHHHHHHHHHH
5fcdA3453EH7.56412999.986576152.12932873.852351
SeqHLLDLACSTGFSSRECFKKE
SSEEEEEECCCCCHHHHHHHHHH
4r12A325348EH7.092550102.370444150.76823042.951820
SeqKYSLYLHTAGTKTSSVTDILDQVA
SSEEEEEEEEEECCCCHHHHHHHHHHH
4l2iB451474EH7.42190195.218701151.00441399.860552
SeqLILCGRQAIDGDTAQVGPEIAEHL
SSEEEEEECCCCCCCCCCHHHHHHHHH
3fd3A101119EH7.38002390.267912131.53932278.246818
SeqGLTFNQKDRLQASWIRTAL
SSEEEECCCCCCHHHHHHHHHH
2olsA204219EH8.434816105.043000140.52997642.985395
SeqVVFVTSSYGLGENVVQ
SSEEEEEEEEECCCHHHHH
From residue 16 to 46 type HE
jmol
SSEHHHHHHHHHHCCCCCCCCCCCEEEEEEEEEE
Distance17.601964Delta141.018718
Theta32.515799Rho319.754647
Geometrically equivalent Smotifs
PDBChainStartEndTypeDDeltaThetaRho
4cymA1747HE18.096001141.00161128.816031318.225100jmol
SeqKTSIIKRYVHQLFSQHYRATIGVDFALKVLN
SSEHHHHHHHHHHCCCCCCCCCCCCEEEEEEEEE
3q3jB116145HE16.837617133.08324239.579903306.962555jmol
SeqKTAMLQVLAKDCYPETYVPTVFENYTACLE
SSEHHHHHHHHHHCCCCCCCCCCCEEEEEEEEE
4rkfA1950HE17.889581140.80091427.716352325.392290jmol
SeqKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFR
SSEHHHHHHHHHHCCCCCCCCCCCCEEEEEEEEEE
3tu3A223HE16.939575126.51524123.687600338.735170jmol
SeqIDTWLAQWGLRLPSSNDATLRL
SSEHHHHHHCCCCCCCCCCCCEEEE
3f02A107153HE17.334179145.21460123.522306317.830950
SeqNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNW
SSEHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEEEEEEEEEEE
3e9cA138184HE16.843102142.00655839.633498341.879035
SeqGAFIRISVRHLVEDLQCCLPAGLKMNQVFSPCPNTGISRFIFTIHRE
SSEHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEE
1mtpA118164HE17.600803141.40156933.010295313.922052
SeqPEGVRATVNADIADATRGMIRELLPQGAVTPDLRAILTNALWAKARW
SSEHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEEEEEEEEEEE
1bifA355388HE17.954512132.25018523.246455308.400814
SeqQAVMRCLLAYFLDKAAEELPYLKCPLHTVLKLTP
SSEHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEE
5fg3A1747HE16.754047138.11185040.770018322.528692
SeqKTTLLDKIRRTAVAAKEAGGITQHIGASIVP
SSEHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEE
4afxA138182HE17.197136137.49322234.274331317.981751
SeqASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKW
SSEHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEEEEEEEEEEE
4v0kA1431HE16.787105135.23008318.807332315.758325
SeqKTTIIERLKGFTVDEVEK
SSEHHHHHHHHCCCCEEEEEE
2ixsA210234HE18.059492134.15571945.792176342.223559
SeqKRIFEETLGLTFDPHGRMPDLVLHD
SSEHHHHHHCCCCCCCCCCCCCCEEEEE
From residue 37 to 58 type EE
jmol
SSEEEEEEEEEEECCEEEEEEEEEE
Distance6.027624Delta74.632504
Theta143.984862Rho285.778785
Geometrically equivalent Smotifs
PDBChainStartEndTypeDDeltaThetaRho
2du3A277308EE6.62888184.073758139.928665289.948180jmol
SeqIKLFSIDRCFRREQGEDATRLYTYFSASCVLV
SSEEEEEEEEEEECCCCCCCCCCCCEEEEEEEEEE
4qo5A176196EE6.53075184.211088143.704124278.487503jmol
SeqKVVGTVDTISHGIPVTLVKYE
SSEEEEEEEEEEECCEEEEEEEEE
2j89A3973EE6.65821882.327862138.633040289.009261jmol
SeqVTKTEVGYTQGLLHNPTYEDVTGTTNHNEVVRVQY
SSEEEEEEEEEECCCCCCCCCCCCCCCCCCEEEEEEEE
2dy1A459484EE6.50926986.355101157.504389312.825257jmol
SeqAEGQGKYKKQTGGHGQYGDVWLRLEP
SSEEEEEEEEEEEECCEEEEEEEEEEEEE
5he3A559577EE6.02332188.935052138.304921282.165027jmol
SeqIQSVEETQIKERKCLLLKI
SSEEEEEEEEEECCEEEEEEEE
1a1xA83102EE6.42728582.107210141.703047292.609460jmol
SeqLWQIQHHLMVRGVQELLLKL
SSEEEEEEEEEEECCEEEEEEEE
2v6vA831EE6.32305884.945962147.616425275.032902jmol
SeqLVKASVESFGLEDEKYWFLVCCEL
SSEEEEEEEEEEEEECCEEEEEEEEEE
5ht2A103122EE5.07921574.708221146.292556299.080721jmol
SeqNLLCVNVSLGGNEFCLMTSH
SSEEEEEEEEEECCEEEEEEEEE
3hjeA672695EE6.47404373.427612147.097605304.922952jmol
SeqYDIEIDGEYTDVITDETVRGRVKV
SSEEEEEEEEEEEECCCCEEEEEEEEE
4wuyA519EE5.24602679.721108134.535992295.139040jmol
SeqLERFCSPGKGRGLRA
SSEEEEEEECCCEEEEEE
2pqcA282302EE6.60639487.472615135.557632289.870136jmol
SeqDIEVINPRLAGGEDVADLRVR
SSEEEEEEEEEEECCEEEEEEEEE
3p6bA4065EE5.74245487.420409138.987830286.986028jmol
SeqGKCDFAVVDVPGEPGNKAFRLTVIDK
SSEEEEEEEEEECCCCCCCEEEEEEEEEE
4xrtA3254EE5.82411081.509136139.677638316.027669jmol
SeqSVHAEPLGRRDGAEEFQHWWVID
SSEEEEEEEEEEECCEEEEEEEEEEE
3w5jA3955EE5.92092787.151348139.430986297.887275jmol
SeqLLSGKILLGADMVEIID
SSEEEEEEEEECCEEEEEEE
1oo0A324EE6.46823189.511161156.088025312.347379jmol
SeqFYLRYYVGHKGKFGHEFLEFEF
SSEEEEEEEEEEEECCEEEEEEEEE
2p9wA235253EE5.66127289.545684144.154822293.015920jmol
SeqTEKIVTVPVGNESVLVGAR
SSEEEEEEEEEECCEEEEEEEE
1wf3A212234EE6.37901984.325544144.191580304.157091jmol
SeqATKVEEVAERENGVLYIKAILYV
SSEEEEEEEEEEECCCEEEEEEEEEE
3kewA207225EE5.56395188.836300139.090203294.053369jmol
SeqIKIRRWEKHKNATRIEYVA
SSEEEEEEEEEECCEEEEEEEE
4xz7A271291EE5.30314488.885371131.967138277.570586jmol
SeqAYVVVGKNAEGVPHATARVYY
SSEEEEEEEECCCCCEEEEEEEEE
4zotA112125EE5.32593188.833969131.033135297.251595jmol
SeqFKVEKEGEGYKIVY
SSEEEEEEECCEEEEEE
4u3vA6786EE6.61588469.961722148.768932297.737475jmol
SeqTIELQAKPLQVIELQIMYRE
SSEEEEEEEEEECCEEEEEEEEE
4rnzA232251EE6.76349878.325576140.677791299.568787jmol
SeqGRVGFMGVKAGYGKVVEIHL
SSEEEEEEEEEECCCEEEEEEEE
3kf3A152171EE5.53355784.434742145.224835312.423040jmol
SeqRDPKVFWHEDSNQWIMVVSK
SSEEEEEEEEECCCCEEEEEEEE
1qd1A212231EE5.27294183.703117145.328510303.500441jmol
SeqVQAIGWYLDEKNLAQVSTNL
SSEEEEEEEEECCCCEEEEEEEE
1a7tA1741EE5.17521780.750119148.480242270.770350jmol
SeqVYTYVSLAEIEGWGMVPSNGMIVIN
SSEEEEEEEEEEECCCEEEEEEEEEEEE
3p51A85113EE6.98215386.480316148.354406279.567856jmol
SeqIYNYVGNLHLLPVTIDDTTFVEWSGSWES
SSEEEEEEEEEEEEEECCCCEEEEEEEEEEEE
3cb0A120147EE5.59840487.079338147.740255289.553497jmol
SeqAAFDCRVVSVQDHSTHHVLFGEVVGLSS
SSEEEEEEEEEEEEEECCEEEEEEEEEEEEE
3cu9A4661EE5.31318780.921217141.777251304.875658jmol
SeqQIKTSEDGVHWENMGW
SSEEEEEECCCCEEEEEEE
4z4dA549575EE5.79849664.230025158.318761315.319548jmol
SeqVIFLGADVTHPPAGDGKKPSIAAVVGS
SSEEEEEEEEEECCCCCCCCCCEEEEEEEE
4pitA7093EE7.00281284.927453142.963601269.845887jmol
SeqLVGMAGEVANYTGAVVLGKLGFST
SSEEEEEEEEEEEECCEEEEEEEEEEE
3ttcA396420EE6.98578766.189426133.044055298.857192jmol
SeqVIALTLDGIGMGENGALWGGECLRV
SSEEEEEEEEEEEECCCCCEEEEEEEEE
4j15A210230EE6.99412975.603928130.720102294.568288jmol
SeqKVFSIGPVFLTEFVGLDIEMA
SSEEEEEEEEECCCCEEEEEEEEE
1jz8A882909EE5.47003268.322159130.411461306.320959jmol
SeqRVNWLGLGPQENYPDRLTAACFDRWDLP
SSEEEEEEEEECCCCCCCCCCCCEEEEEEEE
1rypG15831600EE6.22619988.374710155.159622314.055952jmol
SeqVSTIFGGVDKNGAHLYML
SSEEEEEEEEEECCEEEEEEE
1sjwA75111EE5.93372382.019529146.959286266.675490jmol
SeqWVKAYLVLYGRHVGRLVGMPPTDRRFSGEQVHLMRIV
SSEEEEEEEEEEEECCCCCCCCCCCCCEEEEEEEEEEEEE
2wryA6986EE6.25181187.311018134.216472279.773162jmol
SeqLYMSCVMSGTEPTLQLEE
SSEEEEEEEEECCEEEEEEEE
3p5jA2044EE6.11923369.607734153.940453305.863158jmol
SeqCVLGVDEAGRGPVLGPMVYAICYCP
SSEEEEEEEEECCCCCCCCEEEEEEEEE
2x78A629EE6.34157470.687252146.575758305.921605jmol
SeqKFFIDYIGPLPPSQGYLYVLVVVD
SSEEEEEEEECCCCCCCCCCEEEEEEE
4dovA5077EE5.17624071.914156150.261802309.190441jmol
SeqYVAKLIELFQNGAEVPPKKCARVQWFVR
SSEEEEEEEEEEEECCCCCCEEEEEEEEEEE
4k8lA263283EE6.36085380.023876133.266949273.174005jmol
SeqCRLDKTLELGGKPAISPIISG
SSEEEEEEEEEECCEEEEEEEEEE
4xtqA91111EE6.04490586.433977151.119197308.552753jmol
SeqTEYCGLMHRPPEGGLIIELER
SSEEEEEEEEECCCCCCEEEEEEE
1unqA7390EE5.24151782.219165140.984719295.196325jmol
SeqTFIIRCLQWTTVIERTFH
SSEEEEEEEEECCEEEEEEEE
2qiyA73102EE6.84496382.028574143.130021275.044243jmol
SeqLKLKLDTIDFQYTGHLHKSILIMATGEMFW
SSEEEEEEEEEEEEEECCCCCEEEEEEEEEEEE
1usrA287309EE6.82085478.719906144.217084299.089273jmol
SeqSHFLYQRGSSYFSPALLYPMTVS
SSEEEEEEECCCCCCCCEEEEEEEEE
4j7nA189208EE6.04808982.582832153.409684296.376109jmol
SeqAYCSVLRSRLGNHPLLFSGE
SSEEEEEEEEEEECCEEEEEEEE
2porA234EE6.48788069.231376145.688838261.703174jmol
SeqVKLSGDARMGVMYNGDDWNFSSRSRVLFTMSGT
SSEEEEEEEEEEEEEECCCCEEEEEEEEEEEEEEEE
3sc7X152170EE5.03198385.454082147.298519307.848197jmol
SeqRDPKVFFHRQSGNWIMVLA
SSEEEEEEEEECCCCEEEEEEE
3p8kA81102EE6.56468985.313158146.944642295.035229jmol
SeqDIVAGSVSNIRNNQIFNTAFSV
SSEEEEEEEEEEEECCEEEEEEEEE
3g7kA322EE5.10418273.532782146.439834274.192708jmol
SeqQMRIPCVIMRAGTSKGIFLK
SSEEEEEEEEEEEECCEEEEEEE
4pitA3453EE6.95232582.957716146.020821301.818489jmol
SeqVDGVDVTFTYYGKTETRHYG
SSEEEEEEEEEEECCEEEEEEEE
4r82A115142EE5.69064869.201591148.032705292.212931jmol
SeqAHLECAIHRLYEGGDHTIFLGEVITATR
SSEEEEEEEEEEEEEECCEEEEEEEEEEEEE
4pdyA2337EE5.07295588.778991141.878820308.450134jmol
SeqIQQRHADGNIEVWTD
SSEEEEEEEECCEEEEEE
4gs3A6288EE6.50000582.344610144.912001269.785504jmol
SeqRVKIEGQLRSYNRKLILTVFARDISVV
SSEEEEEEEEEEEEECCEEEEEEEEEEEEE
1qhtA1331EE5.38553282.768380150.524460293.906365jmol
SeqKPVIRVFKKENGEFKIEYD
SSEEEEEEEEEEECCEEEEEEE
3v0aB20722089EE5.14758483.565154157.503042299.650014jmol
SeqYELVLYAFKEPGNNVIGD
SSEEEEEEEEEEECCEEEEEE
3rriA90111EE6.62383487.010017142.267659310.599326jmol
SeqFYHDLSRRFEGLIEEHETFFLI
SSEEEEEEEEECCCCCCCEEEEEEE
2fh1A3556EE5.12836679.744325149.791200297.193929jmol
SeqSYIILYNYRHGGRQGQIIYNWQ
SSEEEEEEEEEEECCEEEEEEEEEE
2r4fA337360EE5.93043788.821517136.292016298.058244jmol
SeqCITLMEASGPTNEDLYISCTMPSI
SSEEEEEEEEECCCCCEEEEEEEEEEE
3sc7X316333EE5.81972181.607395133.466380286.284453jmol
SeqRTLSLKKVGTQQHFVQQP
SSEEEEEEEEECCEEEEEEEE
4jhtA5466EE5.52491587.244354134.989959307.229396jmol
SeqLGWTTHRQGYLYS
SSEEEEEEECCEEEEE
12asA192237EE5.24925676.039632144.207137313.656501jmol
SeqAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWN
SSEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEE
4rfzA1936EE6.26385889.039045136.735155291.787991jmol
SeqGVVKYGKWRGQYDVAIKM
SSEEEEEEEEECCCEEEEEEE
4lsdA623EE6.44711869.795193147.820380311.699900jmol
SeqVNVTVRHLKANSAVVSWD
SSEEEEEEECCCCCCEEEEEE
4qp5A4868EE6.75407378.044808141.955233301.334141jmol
SeqGKIVEAGWSNYGGGNQIGLIE
SSEEEEEEEEEECCCCEEEEEEEE
1tigA6685EE6.63016885.707422143.151234302.796082jmol
SeqAVVETAPKMDGRNMFLVLAP
SSEEEEEEEEEEECCEEEEEEEE
3mh9A257278EE5.50482785.047302147.682802297.260214jmol
SeqAATGNWKLTLGGSDIDADFVVF
SSEEEEEEEEEEECCEEEEEEEEEE
4lptA421EE6.01269976.946693145.147376310.818176jmol
SeqKNLVVSEVTEDSLRLSWT
SSEEEEEEECCCCCCEEEEEE
4wt5A110123EE5.36174485.651639130.001776290.116630jmol
SeqYYLVVAENGLKLEK
SSEEEEEEECCEEEEEE
2w0iA5780EE6.87531874.518598144.711165278.229077jmol
SeqRYHFFLYKHTHEGDPLESVVFIYS
SSEEEEEEEEEEEECCEEEEEEEEEEE
3juwA144161EE5.17421378.981353137.498186284.771815jmol
SeqRGYSDVAFDGAAHLLLER
SSEEEEEEEEECCEEEEEEEE
3okyB819846EE5.37594788.023503141.803871287.020983jmol
SeqYIYFFFREIAVEYNTMGKVVFPRVAQVC
SSEEEEEEEEEECCCCCCCCCCEEEEEEEEE
5c1mA154167EE5.09585887.328316133.760982303.367667jmol
SeqATTKYRQGSIDCTL
SSEEEEEEECCEEEEEE
4n1iA2545EE5.26164386.521351141.007418282.085692jmol
SeqSLKDFTHVPYNGQHLVYASYH
SSEEEEEEEEEEECCEEEEEEEEE
1rz1A102129EE5.30250178.705013148.306194285.908978jmol
SeqAQISCQVVNEVQAGDHTLFIGEVTDIKI
SSEEEEEEEEEEEEEECCEEEEEEEEEEEEE
4tkbA8098EE5.95691086.923847141.456616293.076965jmol
SeqKVKSIVTLDGGKLVHLQKW
SSEEEEEEEEEECCEEEEEEEE
1pz7A6479EE5.38904285.693330137.044620307.320358jmol
SeqYIALAIVDGFVQMMYD
SSEEEEEEEECCEEEEEEE
2jaeA267283EE5.39858089.364614143.174812302.354531jmol
SeqGVTVEYTAGGSKKSITA
SSEEEEEEEEECCEEEEEEE
4z54A5170EE5.08824084.592572144.864973289.019557jmol
SeqKAIGHVIEEGGVKMKLTVID
SSEEEEEEEEEECCEEEEEEEEE
3u9rB328345EE5.37453181.368252140.121614295.986666jmol
SeqLVCGFAHLHGYPIAILAN
SSEEEEEEEEECCEEEEEEEE
3k7uC124151EE6.94776579.498105146.676254262.880727jmol
SeqVTLVGVVHDIQSGFVYEDAVTQFTLTTT
SSEEEEEEEEEEEEEEECCCCEEEEEEEEEE
4m62S536545EE6.34699070.329057149.671607314.367327jmol
SeqGLPVEPVGVA
SSEEECCCCCEEE
5j42A95112EE5.95747285.548139147.177904300.848251jmol
SeqNLLCVNVSLGGNEFCLMT
SSEEEEEEEEEECCEEEEEEE
4c0kA280298EE5.17802386.997010138.279187280.013872jmol
SeqNCINSVQVYGQEKHLILRD
SSEEEEEEEEECCEEEEEEEEE
3proC241260EE5.78935989.490725143.759574306.612981jmol
SeqFAGSWIERNEDGSFKLVAAT
SSEEEEEEEEECCCCCEEEEEEE
3r75A519551EE6.09444579.847944140.699352294.083897jmol
SeqLVRREVPNQGIQVEIDLFGQRERVGFYNTYVAQ
SSEEEEEEEEEEEEEEEEEECCEEEEEEEEEEEEEE
4n1iA7795EE5.46057683.265523147.068424307.573751jmol
SeqVAPTVFYFTPKKLWFLVSQ
SSEEEEEEEEECCCCEEEEEEE
3uqcA2744EE5.22690386.106628139.518309299.832110jmol
SeqQFWQALDTALDRQVALTF
SSEEEEEEEECCCCEEEEEEE
3h8kA2341EE6.77632684.887841144.436293313.792239jmol
SeqIVAGPMNEENFFEWEALIM
SSEEEEEECCCCCCCEEEEEEE
2a4xA98115EE6.91275583.430162141.525602310.816689jmol
SeqGHLKPWNAVWGQRYAIVK
SSEEEEEEEEECCCEEEEEEE
3i6eA427EE5.20751189.552058155.419151300.364166jmol
SeqKIIAMDLWHLALPVCEIVVLRLVA
SSEEEEEEEEEEEECCCCEEEEEEEEE
2wjsA227242EE5.76964987.554248139.677214309.122140jmol
SeqFMSVELSDGHVKVSYD
SSEEEEEEEECCEEEEEEE
3wz4A7589EE6.41821586.594511135.974689306.564924jmol
SeqILQKGVLNGRYSWRV
SSEEEEEEEECCEEEEEE
3mxtA227257EE6.86944471.948721153.449451309.092219jmol
SeqIKIDYIELVDFNTENIENITDNVLGAVAAFV
SSEEEEEEEEEECCCCCCCCCCCCCEEEEEEEEE
1pmhX2750EE5.74094184.774865138.188144310.470277jmol
SeqIKKVSVSQDLQRPGNKYALRLDVE
SSEEEEEEEECCCCCCCCCCEEEEEEE
4omfA549568EE5.07272688.645545142.910025297.663463jmol
SeqLGIGAIEAPRGLDVHMAKVE
SSEEEEEEEEECCEEEEEEEEEE
1k07A153171EE5.19227284.169082146.958040301.745496jmol
SeqTTWTMKLKDHGKQYQAVII
SSEEEEEEEEEECCEEEEEEEE
3f9xA2640EE5.28584287.995022133.405862296.226253jmol
SeqMKIDLIDGKGRGVIA
SSEEEEEEECCCEEEEEE
4wipA4461EE5.46567481.359198144.273853287.904962jmol
SeqKYFFKSMDQDFGVVKEEI
SSEEEEEEEEECCCEEEEEEE
5hx0A336359EE6.12622287.302885136.010819283.530866jmol
SeqRVLVSYYFNVPGGPQHIAGSILEI
SSEEEEEEEEECCCCCCCEEEEEEEEE
5amhA5073EE5.08477163.573795134.617671298.757610jmol
SeqLRLIGAPSGEFSWFKGYDWTIALC
SSEEEEEEEEECCCCCCCCCEEEEEEE
5a7vA338355EE5.57451189.274835139.698809293.877140jmol
SeqKWYLYYGCADSKVGMAIY
SSEEEEEEEEECCCEEEEEEE
5al7A1244EE5.64021879.635800151.036329284.590764jmol
SeqVVNILPSVEMLVNFNGDMTRSSKRSCLLYAERV
SSEEEEEEEEEEEEEEECCCCCCCEEEEEEEEEEEE
4joiA89113EE5.22738775.496861145.808388275.406041jmol
SeqTIRVRGSIRTYREEREIHATTYYKV
SSEEEEEEEEEEEECCEEEEEEEEEEEE
3ehgA6078EE6.88086983.946654147.347664306.526695jmol
SeqTCRVDIQQLWKEVVITVSD
SSEEEEEEEEEECCEEEEEEEE
1s5jA1132EE5.47119486.088070143.969842279.579140jmol
SeqIYFLLQVDYDGKKGKAVCKLFD
SSEEEEEEEEEEECCCCEEEEEEEE
2yzyA82102EE5.32366869.640961148.908957272.091894jmol
SeqDLRLEGEVRLPEGMAWKLVGR
SSEEEEEEEEEEECCEEEEEEEEE
1xeuA235262EE6.16514269.184352147.108201263.059266jmol
SeqEVSYKFSEYINVGETEAIFDGTVTQPIK
SSEEEEEEEEEEEEECCEEEEEEEEEEEEEE
5a67A147167EE5.31452986.917924156.571712312.353575jmol
SeqVKLEVDETKYDFGNCYEIECE
SSEEEEEEEEEEECCEEEEEEEEE
4r8fA91114EE6.14831969.919034139.248414274.060392jmol
SeqTVKLKPVSFKDTAEGYGRIAVAPY
SSEEEEEEEEEEEEEECCEEEEEEEEE
3ijwA191208EE6.40749884.138751132.735897282.471930jmol
SeqKVGAPIIENGERVWKEFV
SSEEEEEEEEECCEEEEEEEE
3fg8A83100EE6.09592188.133218140.084445301.037136jmol
SeqIEVTAAADSGALVVHFRD
SSEEEEEEEEECCEEEEEEEE
2h34A1531EE5.36534884.738895146.251558310.033366jmol
SeqDVYEAEDTVRERIVALK
SSEEEEEEEECCCCEEEEEE
4gz1A102119EE6.16669883.810903146.934089300.513726jmol
SeqNLLCVNVSLGGNEFCLMT
SSEEEEEEEEEECCEEEEEEE
1deuA213232EE6.18645288.400320150.253835268.557856jmol
SeqHVVSVAGWGISDGTEYWIVR
SSEEEEEEEEEEEECCEEEEEEE
2etjA1335EE5.32183368.858903153.931633316.760679jmol
SeqVAGVDEAGRGCLAGPVVAAAVVL
SSEEEEEEEECCCCCCCCEEEEEEEE
2ywwA3454EE5.77837163.993586136.385975283.616202jmol
SeqVMIAINVPSKKKGKKDILKIE
SSEEEEEEEEEECCCEEEEEEEEE
3ti9A253272EE5.37742088.488753129.973030288.858868jmol
SeqILSTIDVGQAGPVRSSYGMK
SSEEEEEEECCCCCCCCEEEEEE
3pz7A4563EE5.47524580.445537149.916062288.890190jmol
SeqHRYHFKAMDPEFGTVKEEI
SSEEEEEEEEEECCCEEEEEEE
4q5eC279301EE5.11246461.507939146.414768311.055180jmol
SeqTWQGLIVPDNPPYDKGAFRIEIN
SSEEEEEEECCCCCCCCCCEEEEEEE
4jbdA136159EE6.80766885.490305146.074867284.197625jmol
SeqSYRYRQHVAVNVPGHGVVHGDIAW
SSEEEEEEEEEEEEECCCEEEEEEEEE
3zy7A88107EE5.49243983.441946147.032999302.943813jmol
SeqMRIKLTFNWNGYKVQSEAEV
SSEEEEEEEEEECCEEEEEEEEE
3d2fA98113EE6.10110586.994179138.127682296.410096jmol
SeqKTGAEVRFAGEKHVFS
SSEEEEEEEEECCEEEEEE
3hq1A479498EE5.42615488.558128139.917363286.868606jmol
SeqTSITATVKINGVETEISGSG
SSEEEEEEEEEECCEEEEEEEEE
4c0gA5983EE5.47342982.997596145.008022290.866047jmol
SeqFEQGTYIYFDYEKWGQRKKEGFTFE
SSEEEEEEEEEEECCCCEEEEEEEEEEE
4cc0A133156EE7.02549571.185851156.817412308.600534jmol
SeqSRQWQTLKQNTGVAHFEYQIRVTC
SSEEEEEEEEEECCCCCEEEEEEEEEE
5aqzA102116EE6.12360589.284943137.848685291.737108jmol
SeqKPKVQVSYKGETKAF
SSEEEEEEEEECCEEEEE
3edpA107129EE6.10909183.892417149.007683286.595531jmol
SeqLVYSIKFVQKSEHGATLDRLILP
SSEEEEEEEEEEEECCEEEEEEEEEE
1jb7B575612EE6.20018577.136655148.735933276.199151jmol
SeqVIVINNWSLELRRVNSAEVFTSYANLEARLIVHSFKPN
SSEEEEEEEEEEEEEECCCCCCCCCCCCEEEEEEEEEEEEE
2d42A101122EE5.24347287.348945150.757606299.597405jmol
SeqGKYFANLFFEQVGLSGRIAFEG
SSEEEEEEEEEECCCCEEEEEEEEE
1tu1A7295EE5.66281765.479786143.830168307.482008jmol
SeqKLHKRWDINIHGHAAVLLDYQWQR
SSEEEEEEEEEEECCEEEEEEEEEEEE
3agnA6089EE6.29702688.694825133.490313306.096253jmol
SeqWSEFPLVYNGPYYSSRDNYVSPGPDRVIYQ
SSEEEEEECCCCCCCCCCCCCCCCCCCEEEEEE
1pj5A630644EE5.27717289.591491141.734836309.050195jmol
SeqRAKNVVIGGIPVTAM
SSEEEEEEEECCEEEEEE
4k3jB447471EE6.32452685.049867137.238392282.204913jmol
SeqFIYFLTVQRETLDAQTFHTRIIRFC
SSEEEEEEEEEECCCCCCCEEEEEEEEE
2r4fA98116EE5.59285489.451702140.959498296.416743jmol
SeqVGVAGPLCLDEKEFQVPMA
SSEEEEEEEEEECCEEEEEEEE
1w2tA1335EE5.51484081.982773149.202688283.009467jmol
SeqGWMNDPNGLIFWKGKYHMFYQYN
SSEEEEEEEEEEEEECCEEEEEEEEE
3phzA4459EE6.33776288.495364136.939578310.204105jmol
SeqWLIEPVGEADTYTVRN
SSEEEEEECCCCCEEEEEE
2qtpA234EE6.19274181.224238144.362867300.744688jmol
SeqIRKIAVFIEETRIEAGREISPPTRKAVAVAVIE
SSEEEEEEEEEEEEEEECCEEEEEEEEEEEEEEEEE
3oxhA220238EE6.40343185.043095146.313879307.196572jmol
SeqQVIAEPADIPSVGRFAVLS
SSEEEEEEEEEECCCEEEEEEE
1q3lA423EE5.51507886.456924142.221888282.613466jmol
SeqVEKIIDRRVRKGMVEYYLKW
SSEEEEEEEEEEECCEEEEEEEE
3dbxA186209EE6.03239377.454522139.454925288.845786jmol
SeqMAVVFARTAGQVQLLLVCRVTSFY
SSEEEEEEEEEECCCEEEEEEEEEEEE
4gy7A7996EE5.09225378.503464141.948349299.100507jmol
SeqAVQVEATFPDGTKLVTVH
SSEEEEEEEEECCEEEEEEEE
1gqiA97114EE5.15347075.040815141.406586300.667320jmol
SeqYLLEQTRINKRHVVIVAA
SSEEEEEEEEECCEEEEEEEE
1xrtA322361EE5.76653668.287282137.869162259.457992jmol
SeqITIFDPNKEWILNEETNLSKSRNTPLWGKVLKGKVIYTIK
SSEEEEEEEEEEEECCCCCCCCCCCCCCCCCCEEEEEEEEEEE
5fviA139160EE5.79419478.273829137.365043315.221241jmol
SeqSTEKMYVRDGVLTGDITMALLL
SSEEEEEEEEECCEEEEEEEEEEEE
5fg3A231253EE6.50577576.291488138.907538291.469316jmol
SeqKGVVLEVKEMQGFGTVVDAVIYD
SSEEEEEEEEEEECCCEEEEEEEEEE
3vwcA84101EE5.84029181.656465143.739345316.226738jmol
SeqWIVTHQPQHGENVFTVVN
SSEEEEEECCCCCCCEEEEEE
3kstA7692EE5.86218188.659998139.631001294.430737jmol
SeqKFYLFYSAEEHICVATS
SSEEEEEEEEECCEEEEEEE
3tm4A338360EE6.87051182.899484141.139398278.176592jmol
SeqFEIIHHRVIGHGGLMVHLYVVKL
SSEEEEEEEEEEEECCEEEEEEEEEE
2vqpA5776EE5.20179676.770887146.117574285.625459jmol
SeqNILVKQISTPKGPSLRVMIN
SSEEEEEEEEEECCEEEEEEEEE
3errA353391EE5.30157165.497493144.033186287.973842jmol
SeqLRYAGYAPAFRSEAGSFGKDVRGLMRVHQFHKVEQYVLT
SSEEEEEEEEEEECCCCCCCCCCCCCCCCCCEEEEEEEEEEE
1sq9A238255EE5.16723079.316885142.477389291.900978jmol
SeqLLAIAHDSNSFGCITLYE
SSEEEEEEEEECCEEEEEEEE
2vhhA148171EE5.23464181.471661155.444704309.827497jmol
SeqVIIHSILERDMEHGETIWNTAVVI
SSEEEEEEEEEEECCCCCEEEEEEEEE
4z48A124146EE6.09546265.426524145.500864279.972951jmol
SeqYDYLLQGEENVDGIDCYILERTP
SSEEEEEEEEEEEECCEEEEEEEEEE
4pqoA525EE6.21940088.081325135.417877285.137411jmol
SeqKISIPYVDFFEDIPVFCIDVE
SSEEEEEEEEEECCCCEEEEEEEE
4mzaA401426EE5.28458583.568312156.750942286.143572jmol
SeqKGYCFHIVEINHKSLDTFQPMLFKTE
SSEEEEEEEEEEEEECCCCEEEEEEEEEE
1a9xB13391372EE5.04563289.144584150.666894308.843216jmol
SeqTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAV
SSEEEEEEEEEEEEEEEEEECCCCEEEEEEEEEEEEE
1pcfA929EE5.16139383.302024134.939525271.112733jmol
SeqRYVSVRDFKGKVLIDIREYWM
SSEEEEEEEEECCEEEEEEEEEEE
1j3mA7691EE5.80326783.856208141.903293300.489502jmol
SeqCNVVLREAEEGVEVLI
SSEEEEEEEEECCEEEEEE
3fhrA6887EE6.28430876.826700137.700747289.065140jmol
SeqILDVYENMHHGKRCLLIIME
SSEEEEEEEEEECCEEEEEEEEE
4u6dA203223EE5.44060684.485702136.212462314.202485jmol
SeqHDPYPIVYKDKIYLYYKSDFD
SSEEEEEEEEECCEEEEEEEEEEE
3ihmA191212EE6.88848375.043444141.104258277.801241jmol
SeqGELIEIPTLSFNGMSTALVLEN
SSEEEEEEEEEEECCEEEEEEEEEE
4f7uP946963EE6.76809686.338939131.444405287.925854jmol
SeqVSLHGISSNPRKCIYFML
SSEEEEEEEEECCCEEEEEEE
4exrA2747EE6.69139075.719431143.964999291.915408jmol
SeqDIVDLSLERDLNKFVYTVEGV
SSEEEEEEEEEEECCEEEEEEEEE
2r9fA116133EE5.05979976.980612140.937035288.165875jmol
SeqIFHFQLWQFGEWVDVVVD
SSEEEEEEEEECCEEEEEEEE
2i4lA195216EE6.02427376.867184137.198584301.395772jmol
SeqAIPMRAETGPIGGDLSHEFIVL
SSEEEEEECCCCCCCCCCEEEEEEE
3wasA6790EE5.76834070.142941149.094890270.093594jmol
SeqMNATLNAGAIKWDGKYLMLVRVEG
SSEEEEEEEEEEEEECCEEEEEEEEEE
4pabA254267EE5.06364986.387300137.088432309.900664jmol
SeqYYLRQERDGLLFGP
SSEEEEEEECCEEEEEE
4fo0A330350EE6.19957668.672627150.260076301.658341jmol
SeqQDHEFQIRHPDSPALLYQFRL
SSEEEEEEEECCCCCCEEEEEEEE
1gjwA606626EE5.89735377.080479147.253305315.315975jmol
SeqKEITGGRVWNGKWSDEEKVVL
SSEEEEEEEEEECCCEEEEEEEEE
3oz2A132149EE6.22051389.124151139.454279300.331545jmol
SeqKVAGAKIRHNNEIVDVRA
SSEEEEEEEEEECCEEEEEEE
4dkkA5372EE6.34705876.212814156.438562314.595205jmol
SeqVEYKDFPKNNKNEFVSLINC
SSEEEEEEECCCCCCCEEEEEEE
2eu9A3353EE5.41024285.522235139.533546293.964504jmol
SeqGKVVECLDHARGKSQVALKII
SSEEEEEEEEECCCCCEEEEEEEE
3a72A98119EE5.43630962.112453146.574944300.266932jmol
SeqLLLAGSSIPTDLSSTDIVLYAS
SSEEEEEEEECCCCCCCEEEEEEEE
2vtfA399421EE5.68791080.845095138.950118303.188979jmol
SeqDLEATFSWEEAFEGGSSLQWHGS
SSEEEEEEEECCCCCCCCCEEEEEEE
4f1wA3147EE6.77138682.933310132.898689297.402602jmol
SeqCEIYTGQLNGTEVALLK
SSEEEEEEEEECCEEEEEEE
3mnmA86103EE6.19422587.481571144.065488306.789735jmol
SeqKWKVNYSVNSTQAEETAV
SSEEEEEEEEECCEEEEEEEE
3hj4A4366EE5.94728074.640199143.980911314.791305jmol
SeqHVELFGSHVSGFCTPHSDADISLT
SSEEEEEECCCCCCCCCCCCCEEEEEE
1i39A224EE6.03827368.846965155.354418316.581655jmol
SeqKAGIDEAGKGCVIGPLVVAGVAC
SSEEEEEEEECCCCCCCCEEEEEEEE
3nfwA113140EE6.18174677.788993145.342886290.878068jmol
SeqAHIDCTVHDVHDGGDHFVVFGKVHGLSE
SSEEEEEEEEEEEEEECCEEEEEEEEEEEEE
3oseA5881EE6.37870174.123298145.443472279.596455jmol
SeqVQWEMEVCKLPRLSLNGVRFKRIS
SSEEEEEEEEEEECCCCEEEEEEEEEE
3kdgA88101EE6.79652784.520679130.565183312.977314jmol
SeqESFGSNSYIVRCHP
SSEEECCCCEEEEEEEE
4l22A173194EE5.14714561.928201147.901361297.599885jmol
SeqKLDRIDILGYHKDSKNYLNLFD
SSEEEEEEEECCCCCCCEEEEEEEE
2ohcA266284EE5.13284985.050539135.049013284.335869jmol
SeqTMIYASIYKNEVRYVALKR
SSEEEEEEEEECCEEEEEEEEE
1q47A217244EE5.45036287.530893143.076837290.239810jmol
SeqKVYFFFRENAIDGEHSGKATHARIGQIC
SSEEEEEEEEEECCCCCCCCCCEEEEEEEEE
2xe4A351368EE6.76793088.186736132.755459288.422242jmol
SeqYLVVAGRRAGLTRIWTMM
SSEEEEEEEEECCEEEEEEEE
4gklA382399EE5.27282884.842499143.754255310.534294jmol
SeqICIHSKNVFNDDIVRVSV
SSEEEEEEEECCCCEEEEEEE
1bquA104121EE6.06606271.007330148.313361314.718668jmol
SeqHNLSVINSLSSILKLTWT
SSEEEEEEECCCCCCEEEEEE
4l82A111138EE6.12924285.451601147.578995294.258729jmol
SeqCYIECNKYASYDAGDHVIFIGEVINTAI
SSEEEEEEEEEEEEEECCEEEEEEEEEEEEE
3c5cA3756EE5.43854478.984735143.175052288.162355jmol
SeqDTYSSEETVDHQPVHLRVMD
SSEEEEEEEEEECCEEEEEEEEE
3lm4A231250EE6.64846786.716423146.416956310.892121jmol
SeqQIEAGPDKHGITQSQFLYVF
SSEEEEEEEEEECCCCEEEEEEE
3v97A357376EE5.04692879.505898144.235794292.670113jmol
SeqADKQYKAKNGPLDCVQKNYH
SSEEEEEEEEEECCEEEEEEEEE
4qxaB174201EE5.62535981.371803142.469305282.639143jmol
SeqTLLYGKNNVLVQPRDDMEAVPGYLSLHQ
SSEEEEEEEEEEEECCCCCCCCEEEEEEEEE
4xloA240271EE6.36147788.039679137.294831288.081967jmol
SeqLTWALYLRLAPPLPELPADMHGKPVICAMSCW
SSEEEEEEEEEECCCCCCCCCCCCCCEEEEEEEEE
3tc8A4873EE5.64925088.926264140.650281278.874543jmol
SeqKVYQQEAILTAYDGTKLEARNIIGSF
SSEEEEEEEEEEECCCCCEEEEEEEEEEE
4fvaA100119EE6.37641985.401198143.232817300.782722jmol
SeqTLQILEGSIGGLKVFLLNTH
SSEEEEEEEEEECCEEEEEEEEE
4c1wA6580EE5.13401384.398177144.208463315.688314jmol
SeqYFTMAVYNNTATLEGR
SSEEEEEEEECCEEEEEEE
3njeA5976EE5.22506084.100941144.024549303.865651jmol
SeqQRVRWSLSGETLERRYWL
SSEEEEEEEEECCEEEEEEEE
1pn2A85113EE6.54013184.998442154.943722260.561276jmol
SeqGEIKTTFEPIATTPKGTNVVIVHGSKSVD
SSEEEEEEEEEEEEEEEECCEEEEEEEEEEEE
3d2lA149173EE6.46444277.909516149.834103302.779189jmol
SeqSSYIWFADPGEEPLSVVHELTFFIE
SSEEEEEEEEEECCCCCEEEEEEEEEEE
2z5eA927EE5.15697475.659745141.760608302.564178jmol
SeqSKQKTEVVCGVPTQVVCTA
SSEEEEEEEEECCEEEEEEEEE
3pmeA97113EE5.52448686.276272150.655721316.184719jmol
SeqSGWKLCIRNGNIEWILQ
SSEEEEEEEEECCEEEEEEE
2rdyA126147EE5.89471285.194272157.135211308.995410jmol
SeqVQYTRELFVTYPDRAIVVRLTA
SSEEEEEEEEEEECCCCEEEEEEEE
4k3jB371388EE5.48298288.179178142.717037304.389344jmol
SeqAKVLSSVKDRFINFFVGN
SSEEEEEEEEECCEEEEEEEE
2v3aA207221EE5.31591887.069823136.709530302.503335jmol
SeqLASLKKAGEGLEAHL
SSEEEEEEEECCEEEEEE
3v0aB21642180EE6.64173388.212941138.388933302.528734jmol
SeqCGWEIYFQDTGLVFNMI
SSEEEEEEEEECCEEEEEEE
3pmeA363386EE6.87821481.254006134.617119294.795303jmol
SeqTMLLADIYKPWRFSFENAYTPVAV
SSEEEEEEEEECCCCCCCCCEEEEEEE
3ozpA129147EE6.77038386.214670132.043037294.032255jmol
SeqYGLRVSPSGADRVNATITA
SSEEEEEEEEECCCEEEEEEEE
4yg0A5171EE6.40567186.758167138.301283288.074758jmol
SeqTAQTNVTVNVMNETVNISIDN
SSEEEEEEEEEEECCEEEEEEEEE
4yllA3857EE5.17057579.528285142.601201294.167106jmol
SeqGQVVKAYDRVEQEWVAIKII
SSEEEEEEEEECCCCEEEEEEEE
3tegA124154EE5.90606377.924017137.235739286.900118jmol
SeqAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLF
SSEEEEEEEEEECCCCCCCCCCCEEEEEEEEEEE
3c2uA419441EE5.22426975.612418145.379652280.787429jmol
SeqNWSSIHVTWNEEKGRIIDLVTAD
SSEEEEEEEEEEECCCEEEEEEEEEE
3pu2A97112EE6.56667484.737134140.064536278.557340jmol
SeqTLVTLQLLPVEGGTEL
SSEEEEEEEEEEECCEEEE
4cofA186216EE5.27633878.289869158.381531277.189355jmol
SeqFSIVEHRLVSRNVVFATGAYPRLSLSFRLKR
SSEEEEEEEEEEEEEEEECCEEEEEEEEEEEEEE
3gniB423438EE5.62663186.575607143.364801315.932345jmol
SeqYRATFIADNELWVVTS
SSEEEEEEEECCEEEEEEE
4qlpA4158EE5.47066877.114227142.062618298.776565jmol
SeqVRYFIDRLAGWYVITSSD
SSEEEEEEEEECCEEEEEEEE
3s1sA4160EE5.06131378.364621142.488967300.000036jmol
SeqYEVVHHELVGSIEADFVIKN
SSEEEEEEEEEECCEEEEEEEEE
3sxxA459490EE5.99497089.184151145.509675281.766415jmol
SeqNSAAACDAKSSPYPLGSPENMYGNAFYSEKTT
SSEEEEEEEEEEECCCCCCCCCCCCCCCEEEEEEE
4l0mA3248EE6.20532487.030249137.091673300.917099jmol
SeqKKIYKGKILGKDVISLT
SSEEEEEEEEECCEEEEEEE
3syjA904918EE6.91455087.482608140.419116297.850692jmol
SeqLRYKLVKNDGEFRLH
SSEEEEEEEEECCEEEEE
1ry9A4059EE5.67993376.807830137.750456289.118280jmol
SeqMPAINIALVNEQVMLWANFD
SSEEEEEEEEEECCEEEEEEEEE
1so7A332352EE6.58371686.767759141.844718295.554044jmol
SeqPLFGCLYEANDYEEIVFLMFT
SSEEEEEEEEEECCCCEEEEEEEE
1n7zB416440EE5.81711869.990121141.821365315.876832jmol
SeqIVVCNSAPYNATESGAGWLVYRCLD
SSEEEEECCCCCCCCCCCCCEEEEEEEE
1zy9A488506EE6.79345780.188863132.441740300.893906jmol
SeqRYEIVSSGTLSGNVKIVVD
SSEEEEEEEEEECCEEEEEEEE
3q6aA7291EE5.83974586.567178144.026273288.085994jmol
SeqHPITIQFEESEAGTVVTTTE
SSEEEEEEEEEEECCEEEEEEEE
4ue0A223EE6.42375788.768737147.585089303.522980jmol
SeqRQGSRVVGFMDFIIALGWQIIP
SSEEEEEEEEEECCEEEEEEEEEEE
1h4vB95121EE5.92612781.865165144.750851296.049862jmol
SeqVRLWMAGPMFRAERPYRQFHQVNYEAL
SSEEEEEEEEEEECCCCCCCEEEEEEEEEE
4wmyA201226EE6.22130085.512955154.898592303.720245jmol
SeqFTAGFVQFRVFNNERAANALCAGMRV
SSEEEEEEEEEEEECCCCCEEEEEEEEEE
3fssA226EE5.87990867.079063148.475973296.589860jmol
SeqNTIFKLEGVSVLSPLRKKLDLVFYL
SSEEEEEEEEEEEECCCCCEEEEEEEEE
4mhcA114139EE6.22436567.514750148.757973308.369092jmol
SeqILKVKLVKPSPNTFVSSVENLLIVAT
SSEEEEEEEECCCCCCCCCCCCEEEEEEE
4binA92115EE5.82320860.762635153.565764306.989542jmol
SeqVKPQLFALAPVAGFKERLVMDLYP
SSEEEEEEEEECCCCCCCEEEEEEEEE
5btoA199218EE6.18045588.204471153.039717297.848795jmol
SeqQYISVIKTGIGEAKMLLAGE
SSEEEEEEEEEEECCEEEEEEEE
3auyA6788EE5.78310383.305687150.443610304.997709jmol
SeqSVYVELDFEVNGNNYKIIREYD
SSEEEEEEEEEEECCEEEEEEEEEE
4ob7A5172EE6.61666486.999227141.928803280.792591jmol
SeqIEVKERTIQANGQSIKLQVVRP
SSEEEEEEEEEEECCEEEEEEEEEE
4ihzA111124EE5.09441785.992359133.647846299.111292jmol
SeqFRIERHGDSYKLVH
SSEEEEEEECCEEEEEE
4r52A6681EE5.18938287.640366137.369301298.756322jmol
SeqAYLNLWVDGRRERADL
SSEEEEEEEECCEEEEEEE
1sz7A132158EE5.78504489.368201144.303923292.008508jmol
SeqMAVEAKFVQDTLKGDGVTEIRMRFIRR
SSEEEEEEEEEECCCCCCCCEEEEEEEEEE
3i45A339359EE6.48808289.163533133.402863271.320135jmol
SeqAWVGRTALRDGKGVMVDWRYV
SSEEEEEEEEEECCEEEEEEEEEE
2byoA105127EE5.72060470.782309144.197243277.946916jmol
SeqTNLQAQGTEVIDGISTTKITGTI
SSEEEEEEEEEEEECCEEEEEEEEEE
4ascA4772EE5.33794584.912250135.615798275.352700jmol
SeqVFVAGGLFYNEDNKEDPMSAYFLQFD
SSEEEEEEEEEECCCCCCCCEEEEEEEEE
1wocA438EE5.60806387.463105152.139926314.155817jmol
SeqLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEE
SSEEEEEEEEEEEEEEEECCCCCEEEEEEEEEEEEEEE
5b0rA200222EE5.65267960.019999147.578698307.194223jmol
SeqKYYALHRPSLKSIGNLDIWIASS
SSEEEEEEECCCCCCCCCCCEEEEEE
4h2wA132164EE6.22375772.095178141.885487289.177086jmol
SeqLRFDVAADCFRREPSKHLDRLQSFRMREYVCIG
SSEEEEEEEEEEECCCCCCCCCCCCEEEEEEEEEEE
5f5wA4882EE5.25403680.500705149.284331303.446224jmol
SeqWNVAYVEPSRRPQDGRYGENPNRLQHYYQFQVILK
SSEEEEEEEEEEECCCCCCCCCCCCCCCEEEEEEEEEE
2covD6285EE5.22040784.401528148.476252290.596532jmol
SeqDYKLTFKVEDRYGQGQQILDRNIT
SSEEEEEEEEEEECCCCEEEEEEEEEE
5btwA220EE6.15488789.473104138.575150287.822339jmol
SeqVTKIIWVSNNGKPNLKIEF
SSEEEEEEEEEECCEEEEEEEE
4eplA442464EE5.68422989.290579142.400656295.428316jmol
SeqVIDFSSYIDVSTDPGHYAIFWEI
SSEEEEEEEEEECCCCCCEEEEEEEE
3ci0J145161EE6.13876787.167070138.032823297.666954jmol
SeqLTVGYRIHDGYLERLAW
SSEEEEEEEEECCEEEEEEE
3nvwA5170EE5.11852179.763306144.791996296.619167jmol
SeqTVMLSKYDRLQDKIIHFSAN
SSEEEEEEEEECCCCEEEEEEEE
4illA205238EE6.87518380.951677152.569043271.254389jmol
SeqRIIGYDLHPVTVAIGESKGNLRKARGVMGWIEFD
SSEEEEEEEEEEEEEEECCCCCCCEEEEEEEEEEEEE
2bkyA5788EE6.32005384.814503153.066328282.102695jmol
SeqIEIKEIRVGSQVVTSQDGRQSRVSTIEIAIRK
SSEEEEEEEEEEEEEEECCCCCEEEEEEEEEEEEE
3itwA92110EE6.50194586.500629146.068568311.462486jmol
SeqDIVQPLQDKPWGLRQYLVR
SSEEEEEEEEEECCCEEEEEEE
3egnA7086EE5.68887987.405621134.037389294.513405jmol
SeqDIRLMKEGRMKGQAFIG
SSEEEEEEEECCCEEEEEEE
3nw0B6379EE5.68744572.338159140.106352309.493790jmol
SeqYKLVELEPKSNTYILIN
SSEEEEEECCCCCCEEEEEE
1uirA216237EE5.34172285.714513146.094436288.703257jmol
SeqYVRSYKNHIPGFFLNFGFLLAS
SSEEEEEEEEEECCCCEEEEEEEEE
4usaA217EE5.21000886.972544137.099998302.785646jmol
SeqIQKVITVNGIEQNLFV
SSEEEEEEEECCEEEEEEE
3proC301318EE5.58576582.071166146.644055315.646726jmol
SeqVQSWYVDPRSNAVVVKVD
SSEEEEEEEECCCCEEEEEEE
3h6rA96111EE6.03193687.123768135.026180314.096314jmol
SeqYILQLVPSTADVYIIR
SSEEEEEECCCCCCEEEEE
1r8oB116130EE5.45524387.732483132.603493292.898071jmol
SeqFKIEEGKSGYKDVYS
SSEEEEEEECCEEEEEEE
3pg6A834EE5.81797966.972117150.982215301.882899jmol
SeqGSMVFTVSRDSLPGYESFGTIVITYSM
SSEEEEEEEEECCCCCCCCCCEEEEEEEEE
3ke7A81107EE5.14154083.174070156.160324294.600178jmol
SeqIAVLTFNLDSYLSDKVIKWNCTEVYRR
SSEEEEEEEEEEEEECCEEEEEEEEEEEEE
2hpwA99122EE6.09994584.147161150.286347300.095783jmol
SeqQYDVKAKVTYENGTLYNRVTVKGT
SSEEEEEEEEEEEECCEEEEEEEEEEE
2ecfA124137EE5.03894588.799640140.641464315.624003jmol
SeqFVSFIRGRNLWVID
SSEEEEEEECCEEEEEE
3gzrA80113EE5.65880979.764307142.828338271.264617jmol
SeqSALAVVTLIQDAYVTPDGRQPRAHDRLTLLAVER
SSEEEEEEEEEEECCCCCCCCCCCCEEEEEEEEEEEE
1y4wA168188EE5.88381387.048158143.104700299.035710jmol
SeqFRDPFVFWHDESQKWVVVTSI
SSEEEEEEEEEECCCCEEEEEEEE
4a3pA106118EE5.93693587.751249132.543229296.113630jmol
SeqARKVVEQGMFCKV
SSEEEEEEEECCEEEE
3u9rB92109EE5.65765684.926525133.777283294.074935jmol
SeqIVAGIGRVEGVECMIVGN
SSEEEEEEEEECCEEEEEEEE
4dwdA325EE5.08095681.862376154.404754305.007525jmol
SeqKIAKVEALSVAGDPTSAFVRITA
SSEEEEEEEEEEECCCCCEEEEEEEE
4f9cA3052EE5.03067587.662050144.727448281.773269jmol
SeqSSVYLATAQLQVGPEEKIALKHL
SSEEEEEEEEEECCCCCEEEEEEEEE
1b7yB833855EE5.31743580.720362146.246551294.079045jmol
SeqALLFEVGRVFREREETHLAGLLF
SSEEEEEEEEEEECCCEEEEEEEEEE
4rfuA3766EE6.49170180.383216140.325834267.341746jmol
SeqVFQLDRPLSIDYSLGTGDVDRAVYWHLKKF
SSEEEEEEEEEEEEECCCCCCCEEEEEEEEEEE
3ze9B675695EE6.33088577.226388144.354917300.365231jmol
SeqAEGTGFTEAPRGSLLHYVKVK
SSEEEEEEEEEECCEEEEEEEEEE
2ecuA101128EE5.85849171.529604147.954169295.815919jmol
SeqAVLRCRLHALYPGGDHRIVVGLVEEVEL
SSEEEEEEEEEEEEEECCEEEEEEEEEEEEE
2oqhA431EE5.73028382.496353150.740343292.059939jmol
SeqITDVDVWVVNLPLVNPFGETRTVVRVRT
SSEEEEEEEEEEEECCCCCCCEEEEEEEEEE
2qdfA5371EE5.44126883.837868148.495633305.229725jmol
SeqFEDVRVLRDGDTLLVQVKE
SSEEEEEEEEEECCEEEEEEEE
4cqbA425EE6.51347877.247777142.373444294.786383jmol
SeqFDLIIRNAYLSEKDSVYDIGIV
SSEEEEEEEEEEECCCCEEEEEEEE
4yecA5977EE5.03366882.465421139.750167291.698085jmol
SeqELLRIKEENGVVKKIHLKD
SSEEEEEEEEECCEEEEEEEEE
4oobA76103EE6.61847078.658538149.699150271.603783jmol
SeqAVGVRVRAENLREHRRGLLVDLVTNVSV
SSEEEEEEEEEEEEEEECCEEEEEEEEEEEE
1w1wA6283EE5.32527083.441459150.092728298.208701jmol
SeqSAYVKAFYQKGNKLVELMRIIS
SSEEEEEEEEEEECCEEEEEEEEEE
4qpwA2944EE6.11256886.168663137.577300312.912387jmol
SeqTTIGKNDTEGCLEIKT
SSEEEEEEECCCCEEEEEE
4yb8B581601EE5.95701384.990125147.255513293.004832jmol
SeqVELIIGLLRDPQFGPTVMFGL
SSEEEEEEEEEEECCCEEEEEEEE
5ezqA273297EE6.69742772.283536146.216059307.279048jmol
SeqFKFSRVCKPKSSLEETEVLFVFIGY
SSEEEEEEEECCCCCCCCCCEEEEEEEE
3u1wA3147EE5.85848983.002965140.656860299.758816jmol
SeqYYVVDFNNGGSETTAWF
SSEEEEEEEEECCEEEEEEE
1yqqA6479EE5.48181484.997824137.099383305.975982jmol
SeqELVLGHLQGVPVVCMK
SSEEEEEEEECCEEEEEEE
2vpzA928EE5.38356689.368895133.078958303.565533jmol
SeqKSVYQICEGCFWRCGIVAHA
SSEEEEEEECCCCCCCCEEEEEE
5fokA136162EE5.40190486.846287158.243475315.331534jmol
SeqRRTTLDVNRMIGDNAAFRLNLMKHDAH
SSEEEEEEEEEEEECCCEEEEEEEEEEEEE
5it0A121141EE5.09502983.039406147.229285298.516372jmol
SeqNIDLIRGVSDYPVIGLELRVS
SSEEEEEEEEEECCCCEEEEEEEE
5it4A120140EE5.18283382.432051147.562774299.508232jmol
SeqNIDLIRGVSDYPVIGLELRVS
SSEEEEEEEEEECCCCEEEEEEEE
3v7dB570587EE5.18818885.539564142.729037300.589180jmol
SeqTLVAAVEKDGQSFLEILD
SSEEEEEEEEECCEEEEEEEE
3vu4A292316EE5.75509686.975228146.501759279.777329jmol
SeqMIETFKVVFDDEMERWLIQMDQREQ
SSEEEEEEEEEEECCCCEEEEEEEEEEE
5h8lA85105EE5.02849675.080041157.668742309.147318jmol
SeqVIPVSFFEEANNAHYNSIAII
SSEEEEEEEEEEECCEEEEEEEEE
2sakA7289EE5.48044987.591917144.224839312.094938jmol
SeqIEVTYYDKNKKKEETKSF
SSEEEEEEEECCCCEEEEEEE
4q0gA7592EE5.82401784.216121133.633217292.504100jmol
SeqIITGIGRVSGRQCVIVAN
SSEEEEEEEEECCEEEEEEEE
4je6A125143EE5.18220087.305908143.742837310.517045jmol
SeqEVVVTGYDRQGKRIEVNAS
SSEEEEEEEECCCCCEEEEEEE
4gdxB505519EE5.70130688.137456147.963881310.375856jmol
SeqVVQAIVRTAGGWAAA
SSEEEEEEEEECCEEEEE
3nvqA363386EE5.34884689.522697147.125411290.872605jmol
SeqYQKVAVHRMQASHGETFHVLYLTT
SSEEEEEEEEEEECCCCCEEEEEEEEE
3ei3A451466EE6.53106489.273622136.323861307.613834jmol
SeqTFFCGNVAHQQLIQIT
SSEEEEEEEECCCEEEEEE
2aegA148175EE5.45708877.345338149.560277291.724307jmol
SeqFAGIHVPQWKSVRKVRDGLTTDDLYGFL
SSEEEEEEEEEEEECCCCCCCCEEEEEEEEE
5cenA2137EE6.24771288.710320136.399181287.164834jmol
SeqGAVFLGRFHGEEVAVKK
SSEEEEEEEEECCEEEEEEE
4gmuA136159EE6.30760889.595815148.522205306.530171jmol
SeqTMYVIPFSMGPLGSPLAKIGIELT
SSEEEEEEEEEECCCCCCCCEEEEEEE
5haxA113138EE5.83894964.998147152.906018315.640024jmol
SeqITAVALVPPKPGVFVKTITHVLVVAT
SSEEEEEEEECCCCCCCCCCCCEEEEEEE
3fhvA6690EE6.39786889.168533135.409487307.091843jmol
SeqQIVVAPDTAGGTGFNNGFTITTNKV
SSEEEEEEEECCCCCCCCCEEEEEEEEE
2rhsA104135EE6.50037079.808590137.428729281.658302jmol
SeqVKIICPGKVYRRDSDDATHSHQFTQIEGLVVD
SSEEEEEEEEEEECCCCCCCCCCCEEEEEEEEEEE
4lwrA5168EE6.45262886.281459135.545298296.745771jmol
SeqGISGRGNIEGHDVRLLLP
SSEEEEEEEEECCEEEEEEEE
1vloA292315EE6.16761688.766844140.087862267.676192jmol
SeqQHEGIITSGTFSPTLGYSIALARV
SSEEEEEEEEEEEEECCCCEEEEEEEE
1rybA4663EE5.94103885.398387139.209917296.260377jmol
SeqSLLGIGSIGEVPVLVVKP
SSEEEEEEEEECCEEEEEEEE
1mh1A4158EE5.51290081.745204142.331813304.308924jmol
SeqNYSANVMVDGKPVNLGLW
SSEEEEEEEEECCEEEEEEEE
2cy2A145165EE5.82836285.207312147.232941279.942093jmol
SeqVLLGEREIELGGAKLWEVAYG
SSEEEEEEEEEEECCEEEEEEEEE
3gz5A223EE5.26867879.376272142.697267287.462919jmol
SeqLLTVDAVLFTYHDQQLKVLLVQ
SSEEEEEEEEEEEEECCEEEEEEEE
3amrA6992EE6.84623673.191528144.216154278.015275jmol
SeqLNNVDIRYDFPLNGKKVDIAAASN
SSEEEEEEEEEEEEECCEEEEEEEEEE
4akrA133157EE6.02439984.682006138.207597286.905872jmol
SeqVSAVYGTKVSEGIKITVCISTCIYK
SSEEEEEEEEEECCEEEEEEEEEEEEEE
1gl4A143159EE6.78354174.264913149.529133295.291225jmol
SeqLVLKQQFSGIDEHGHLT
SSEEEEEEEEECCCCCCCEE
4g75A183218EE6.00338181.740772145.875234273.924091jmol
SeqQTTVDFNVPYATAKDSWVAGNTVGEITLRIVGILVK
SSEEEEEEEEEEEECCCCCCCCCCCCCEEEEEEEEEEEE
4zb3A157187EE6.37679167.556965151.679806281.808994jmol
SeqADFVEVLAFRQSHKAILKKKTDMFFLCVLSP
SSEEEEEEEEEEEEECCCCCCCCEEEEEEEEEEE
4arcA149163EE5.09653486.890520137.728741309.371688jmol
SeqVYKKTSAVEIPQWFI
SSEEEEEEECCCEEEEEE
3a1jB352373EE5.88295286.271781146.294736302.418217jmol
SeqARALKIKLTNKHFPCLTVSVEL
SSEEEEEEEEEECCCCCEEEEEEEE
5jjbA121141EE5.16167582.192410147.764567300.038226jmol
SeqNIDLIRGVSDYPVIGLELRVS
SSEEEEEEEEEECCCCEEEEEEEE
4alzA1936EE6.59695876.339739155.122909314.113526jmol
SeqVVLTSPKEGEPWLLTGYI
SSEEEEECCCCCCCEEEEEEE
4bfgA113132EE5.81076087.502932142.241134316.729286jmol
SeqEVTYFPEKNRSAVCEAMAGK
SSEEEEEEEECCCEEEEEEEEEE
3a0yA127144EE5.64132285.679389137.066009303.680426jmol
SeqKIWTENRENGVVFIFEIP
SSEEEEEEEECCEEEEEEEEE
4mq0A366392EE5.96061578.370691153.468390270.440107jmol
SeqLTSIDGTYGQYKFKDVFTTVTSLSFTT
SSEEEEEEEEEEEEECCCEEEEEEEEEEEE
4dwrA815836EE5.56566383.617487142.501584283.023455jmol
SeqNIGKVEEHEVDGKRVKVIVHRK
SSEEEEEEEEEEECCEEEEEEEEEE
3io5A161177EE5.79827675.657012147.333772303.613477jmol
SeqTVFIIGKRYQFVLNVEK
SSEEEEEEEECCEEEEEEEE
4p4mA152178EE5.28688485.077434132.655600312.152634jmol
SeqKYMGMGRLPPRINTKVYKARRVDIRLI
SSEEEEEEECCCCCCCCCCCCCEEEEEEEE
4yfiA3552EE5.51134183.181805137.121811288.066945jmol
SeqGKVYKGRCRNKIVAIKRY
SSEEEEEEEEECCEEEEEEEE
2iwrA4260EE5.26796386.918739134.488792278.715347jmol
SeqQYKKEMLVDGQTHLVLIRE
SSEEEEEEEEECCEEEEEEEEE
1qexB539554EE5.09660381.628631137.441737300.835395jmol
SeqNIAFSIKENYVTATIS
SSEEEEEEEECCEEEEEEE
4on1A7895EE6.15018887.383449138.871957300.794959jmol
SeqYATIRLQRGGDLIDYIVY
SSEEEEEEEEECCEEEEEEEE
3wndA185207EE5.65317283.716561144.166020301.964568jmol
SeqRIFIDHAFNVTGKGCVVLGVVKQ
SSEEEEEEEEEEECCCEEEEEEEEEE
3ei3A582600EE5.75910781.954540146.130403302.018836jmol
SeqPRSILMTTFESSHYLLCAL
SSEEEEEEEEEECCEEEEEEEE
2q7aA90109EE5.16282487.791868141.527797311.091295jmol
SeqNITQKGTDTNGTTLDIAISL
SSEEEEEEEEECCEEEEEEEEEE
4ay9A5581EE6.95125086.412327143.945435272.837698jmol
SeqCCVAKSYNRVTVMGGFKVENHTACHCS
SSEEEEEEEEEEEEECCCEEEEEEEEEEEE
2ia7A81104EE5.56651887.403627147.979900291.502753jmol
SeqRLLIDIEYRVRSTNTRFNLVYPFY
SSEEEEEEEEEEECCCCEEEEEEEEEE
1y0gA82105EE5.22548181.495669146.009230268.295842jmol
SeqQATFTSTSVKKDGDELDITGDLTL
SSEEEEEEEEEEEEECCEEEEEEEEEE
1s1dA8397EE5.29521886.985303141.665162312.270879jmol
SeqLSDLIVFNGKLYSVD
SSEEEEEEEECCEEEEEE
4lb0A149172EE5.49755383.089187152.679095286.213909jmol
SeqSFVHELDAQIATESWGEIRFDLAY
SSEEEEEEEEEEEEECCCEEEEEEEEE
1g55A122149EE5.26428788.142351150.131400312.814640jmol
SeqFQYQEFLLSPTSLGIPNSRLRYFLIAKL
SSEEEEEEEEECCCCCCCCCCCCEEEEEEEE
3fanA1835EE6.12791881.336915141.374695290.258471jmol
SeqMGSGGVFTIDGKIKCVTA
SSEEEEEEEEEECCEEEEEEE
3nyyA143161EE6.19388482.568891146.763486301.599760jmol
SeqGVVTEKGWLEKGGWRIGIT
SSEEEEEEEEEECCCEEEEEEE
4lp7A5675EE5.31502788.432832140.889796298.255259jmol
SeqTITTLYAASQNGPILKVNAS
SSEEEEEEEEECCCCEEEEEEEE
4bkwA4767EE6.86320273.134109142.528197285.203599jmol
SeqLLSMVKIVNYVNRKCWCFTTK
SSEEEEEEEEEEECCEEEEEEEEE
3v67A97119EE6.16821374.922983145.851066270.159481jmol
SeqYMIAGPVPIVLADSELLMYVGFK
SSEEEEEEEEEEEECCEEEEEEEEEE
5c0pA6385EE6.74988389.564136140.246788292.791751jmol
SeqQDFWAPDVYEYEGRYYLFTTFSN
SSEEEEEEEEEEEECCEEEEEEEEEE
4rkeA4665EE5.87430789.133114140.785582286.817079jmol
SeqEFGARMITIDGKQIKLQIWD
SSEEEEEEEEEECCEEEEEEEEE
4zv9A1235EE5.53409589.024200147.909520271.388755jmol
SeqIFAEYITYPSPNGHGEVRGYLVKP
SSEEEEEEEEEEECCCCEEEEEEEEEE
4q0gA311328EE5.72695682.353594138.627591296.113545jmol
SeqLVTAFARVHGHPVGIVAN
SSEEEEEEEEECCEEEEEEEE
3rt2A108133EE6.49821074.727165143.313734255.151780jmol
SeqSSTISLHSETIDGKTGTLAIESFVVD
SSEEEEEEEEEEEECCEEEEEEEEEEEEE
3h6qA107127EE5.65586877.055602131.765884306.458189jmol
SeqWRIQPADHGADGVYHIVGNVR
SSEEEEEECCCCCCCEEEEEEEEE
4ivkA112129EE7.01755189.270434131.758360271.738738jmol
SeqKVGVETKGENGMALETGP
SSEEEEEEEEECCEEEEEEEE
4pabA614628EE5.83865188.952347137.906881307.136937jmol
SeqQTKSLKISDIPVTAI
SSEEEEEEEECCEEEEEE
2i52A92114EE6.28630982.174210146.388073290.030118jmol
SeqKKVLGVLNYDEGLDYPVMYAKEV
SSEEEEEEEEEEECCCCEEEEEEEEE
1c52A5469EE5.62174489.022951141.055064315.889750jmol
SeqLQGQIEVKGMKYNGVM
SSEEEEEEEECCEEEEEEE
4l3rA5069EE6.52018585.029084135.426584278.305703jmol
SeqTLNFNCADVNGEVTGTVSAH
SSEEEEEEEEEECCEEEEEEEEE
3n9xA1837EE5.08070769.248347140.509506282.283262jmol
SeqYIIKHLIGRGSYGYVYLAYD
SSEEEEEEEEEEECCEEEEEEEE
5docA136153EE5.50671479.900677139.857757299.979694jmol
SeqYSVTLNIVRDHVVISVLC
SSEEEEEEEEECCEEEEEEEE
1xdnA4059EE6.70648589.441892149.674395300.623719jmol
SeqTNFGIYLINQGDHEVVRFAK
SSEEEEEEEEEEECCEEEEEEEE
3zi1A220242EE6.69188985.478360143.325771307.724199jmol
SeqKILTPLVSLDTPGKATVQVVILA
SSEEEEEEEEEECCCCCCCEEEEEEE
1nvpC276303EE5.38238266.558582152.678464308.446312jmol
SeqKWKFHLKDGIMNLNGRDYIFSKAIGDAE
SSEEEEEEEEEEEEEECCEEEEEEEEEEEEE
2izrA6681EE5.89479780.477498139.005561310.602723jmol
SeqVYYFGPCGKYNAMVLE
SSEEEEEEEECCEEEEEEE
3hmcA158178EE5.12850379.281958141.551971279.631621jmol
SeqIWQYTETGNVPGIGKCDLNSL
SSEEEEEEEEEEECCCEEEEEEEE
3ug3A369389EE5.87416786.578934138.337507296.968342jmol
SeqTYNIEGVMFINKMPFSVENAP
SSEEEEEEEEECCCCEEEEEEEEE
4e9jA216EE6.35725885.159940144.936351305.452779jmol
SeqFVPAAHWTINLKDAD
SSEEEECCEEEEEEEEEE
3oqqA125156EE5.44510087.019002154.363880302.701042jmol
SeqVFEYDLKVTECHSQQETVGGKEELLLTLDVRA
SSEEEEEEEEEEEECCCCCCCCCEEEEEEEEEEEE
1qnxA172195EE5.04788471.833628153.638721298.070350jmol
SeqEVGCGSIKYIQEKWHKHYLVCNYG
SSEEEEEEEEEEEECCEEEEEEEEEEE
1gkrA225EE5.30566884.696348153.813483309.696069jmol
SeqFDVIVKNCRLVSSDGITEADILVK
SSEEEEEEEEEEEEECCEEEEEEEEEE
5e3iA104133EE5.28974783.150161141.711079289.178750jmol
SeqRVWYMGPMFRYEKPQKGRYRQFHQFGVETF
SSEEEEEEEEEECCCCCCCCCCCEEEEEEEEEE
4x3fA7392EE5.13643887.212613151.055020306.614664jmol
SeqVHDYGESQMNGEGRTAYLVM
SSEEEEEEEEEECCCEEEEEEEE
3uauA152176EE5.79421988.076819150.461072291.677229jmol
SeqYTLSFDNSINKQENNYLDNLDIKFY
SSEEEEEEEEEEEEECCEEEEEEEEEEE
1w61A6181EE5.19466579.849020145.012688309.904613jmol
SeqFGAFLFDPIEEGADLGIVFMD
SSEEEEEEECCCCCCCCEEEEEEE
3n2wA183206EE5.77508688.266623149.240151288.579958jmol
SeqGIGTSSRVVSAGDTRYTVGVLVQA
SSEEEEEEEEEEEECCEEEEEEEEEEE
1mbmA1431EE5.35198486.941965144.241719290.146635jmol
SeqYGTGSVWTRNNEVVVLTA
SSEEEEEEEEEECCEEEEEEE
4heiA3456EE5.44433983.736980154.918818304.342528jmol
SeqINHVQVILRVEKLRQIAEATLHV
SSEEEEEEEEEEEECCEEEEEEEEEE
3n40P122139EE5.43006986.434560134.292756271.064757jmol
SeqHDWTKLRYMDNHMPADAE
SSEEEEEEEEEEECCEEEEEE
4i90A188205EE5.59728587.355195144.062533314.085872jmol
SeqATFETKINNGSLNLKVQD
SSEEEEEEEECCCCEEEEEEE
2aznA194212EE5.53493787.728669138.681502290.043713jmol
SeqLELKNFYRLGEGIVLEFKV
SSEEEEEEEEEECCEEEEEEEE
1a3aA75102EE5.38917260.491593137.431343302.459668jmol
SeqGVVFCQYPEGVRFGEEEDDIARLVIGIA
SSEEEEEEEEEEEEECCCCCCCEEEEEEEEE
4ybfA82110EE6.28861881.261025155.882724286.118560jmol
SeqSSIGTWGQDTIYLGGTSITNQRFADVTST
SSEEEEEEEEEEEEEECCEEEEEEEEEEEEEE
1w61A150174EE5.18727888.886941152.071206299.563165jmol
SeqSFLYQQDVVVVLPKPYGEVRVDIAF
SSEEEEEEEEEEEECCCCCCEEEEEEEE
1yq2A836857EE6.40346584.940943144.869422296.127268jmol
SeqVAVEENWQLDGGELCLRIDITP
SSEEEEEEEEEEECCEEEEEEEEEE
1wmsA3857EE5.40263382.805381144.189978284.168223jmol
SeqEFLNKDLEVDGHFVTMQIWD
SSEEEEEEEEEECCEEEEEEEEE
4jzjC81100EE5.48845189.075986147.678337308.503328jmol
SeqAENLTCWIHDVDFLSCSWAV
SSEEEEEEEEEECCCEEEEEEEE
4emeA127154EE6.36424986.281326146.217523255.345351jmol
SeqLGLSGQVLYKKGNKLVEKLIQINKSVLF
SSEEEEEEEEEEEECCEEEEEEEEEEEEEEE
4k45A4059EE5.06971687.928667139.032257280.243506jmol
SeqSYAISFRAEGKIKHCRVQQE
SSEEEEEEEEECCEEEEEEEEEE
5a7vA5575EE6.53189689.514794138.251406282.137361jmol
SeqDTFNPAATLHDGKIVVLYRAE
SSEEEEEEEEEEECCEEEEEEEEE
2d0bA92114EE5.83095268.837478152.981004312.974640jmol
SeqAIGSDEVGTGDYFGPIVVAAAYV
SSEEEEEEEECCCCCCCCEEEEEEEE
4pvaA86104EE5.38458085.774700144.217326303.051379jmol
SeqAAPQVFYFEPHKLWYLVYQ
SSEEEEEEEEECCCCEEEEEEE
5ifrA2542EE6.95572487.343044140.028360311.279899jmol
SeqCSAGPVGDDMFHWQATIM
SSEEEEEECCCCCCEEEEEEE
4h3sA558577EE5.88893981.133042140.876964309.546705jmol
SeqGYFTLDKESTTSKVILNRIV
SSEEEEEECCCCCCCCCEEEEEE
3m1uA230250EE6.41558080.713955141.502302280.713449jmol
SeqRTVLVPVRAPEGHAVVVPVLL
SSEEEEEEEEECCCCEEEEEEEEE
1w2tA148168EE5.57799279.631052145.134952284.541353jmol
SeqWRMVLGSGKDEKIGRVLLYTS
SSEEEEEEEEEECCCEEEEEEEEE
4fyyB346366EE5.45564662.703079138.595725284.422689jmol
SeqITIGLNLPSGEMGRKDLIKIE
SSEEEEEEEEEECCCEEEEEEEEE
1rypK24282447EE6.29201384.711150155.599265315.948599jmol
SeqVNVLIGGYDKKKNKPELYQI
SSEEEEEEEEEECCCCEEEEEEE
5dltA665709EE5.11375184.056624148.526140314.748914jmol
SeqVNVISGPIFDYNYDGLRDTEDEIKQYVEGSSIPVPTHYYSIITSC
SSEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEE
4y8wA3144EE5.08668787.134509134.339111306.589301jmol
SeqIYRLHLGLQDVVVL
SSEEEEEEECCEEEEEE
2nnrA5177EE5.58242560.305578154.365969310.965599jmol
SeqFTVENKYFPPDSKLLGAGGTEHFHVTV
SSEEEEEEEEECCCCCCCCCCEEEEEEEEE
4udgA288306EE5.32613988.966359140.816974288.184148jmol
SeqRIAIYYGCADTVTGLAFGY
SSEEEEEEEEECCCEEEEEEEE
1xkwA162196EE6.20643184.587857158.849883315.723989jmol
SeqVRGRAVAAYEDRDYFYDVADQGTRLLYGVTEFDLS
SSEEEEEEEEEEEEEECCCCCCEEEEEEEEEEEEEEEE
4f2nA134153EE5.19145785.490649143.542420300.839931jmol
SeqGWTWLCVDPQTKELLIDSTS
SSEEEEEEEEECCCCEEEEEEEE
1yc9A5391EE6.79768777.642170141.020019275.181293jmol
SeqDLGLAASATESKVSERYQSATPPDGWNDYGTLTLNFQYD
SSEEEEEEEEEEEEECCCCCCCCCCCCCEEEEEEEEEEEEEE
4am6A322342EE7.01455071.773693145.124065296.101904jmol
SeqQLYNFMNRSPNQPTEKYEFKL
SSEEEEEEEECCCCCCEEEEEEEE
4zcbA8198EE5.39903088.074907144.061209290.483157jmol
SeqHVKALVTWEGDVLVCVQK
SSEEEEEEEEEECCEEEEEEE
2f9iA89106EE6.22104285.715044133.817466289.743850jmol
SeqMIGGIGFLNGRAVTVIGQ
SSEEEEEEEEECCEEEEEEEE
2zxrA461486EE5.02762687.199923155.929065269.796171jmol
SeqVEVAGLLSENAWNGHLAYEVQAVDLR
SSEEEEEEEEEEEEECCEEEEEEEEEEEE
2i46A91126EE6.61692081.124048145.746465292.988680jmol
SeqRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTE
SSEEEEEEEEEEEEEECCCCCCCCEEEEEEEEEEEEEEE
3rriA3852EE5.62997488.636990135.252056310.011475jmol
SeqRITLDFFGDQLVCHL
SSEEEEEEECCEEEEEEE
4rgyA225EE5.32985177.040024146.939522282.534078jmol
SeqMALFQCDFFSDVLGLSTSMTVILP
SSEEEEEEEEEEECCCCEEEEEEEEEE
4ftbA154176EE5.93251083.972672146.329445280.441544jmol
SeqKLSTVQFPVATDPATSSLVHTLV
SSEEEEEEEEEECCCCCEEEEEEEEE
3ugfA163182EE5.66101382.471447145.049663276.843478jmol
SeqWRIAIGAKYNTTGIAMVYET
SSEEEEEEEEEECCEEEEEEEEE
4zznA2746EE5.32079382.294012140.455574290.308035jmol
SeqGMVCSAYDNLNKVRVAIKKI
SSEEEEEEEEECCCCEEEEEEEE
5j75A206223EE5.77366388.773914143.663827289.637380jmol
SeqADYYCAAWDDGLSGYVFG
SSEEEEEEEEEECCCCEEEEE
3mwxA219EE5.86154583.152369135.214738287.455928jmol
SeqNFIEKITYLGTPAIKAGN
SSEEEEEEEEECCEEEEEEEE
1jlyA6782EE5.29007674.375264139.482685309.782751jmol
SeqYLVRWSPNHYWITASA
SSEEEEECCCCCCEEEEEE
2im9A250267EE5.85684578.984794146.791277303.328891jmol
SeqELFFRQASSQYGKVVDVS
SSEEEEEEEEECCCCEEEEEE
4zh0A182205EE5.68436588.500102140.007120262.484750jmol
SeqDGTKTKIQTIDGKSVTTTISSKVV
SSEEEEEEEEEEECCEEEEEEEEEEEE
5iq9A138159EE5.34172588.444265140.266842310.155814jmol
SeqSVFPLAPSSKTAALGCLVKDYF
SSEEEEEEEEEECCEEEEEEEEEEE
3ddcB255271EE6.98340887.920051136.963360284.783874jmol
SeqFALFKRIHKDGQVLFQK
SSEEEEEEEEEECCEEEEEE
4luqC882908EE5.67480985.446164143.314624277.342793jmol
SeqGEARYKVEEDDGGSAGSEYRLWAAKPA
SSEEEEEEEEEEEEEECCEEEEEEEEEEEE
3sh4A6378EE5.86741089.442218137.271948306.800036jmol
SeqFISLGLQDGHLVFRYQ
SSEEEEEEEECCEEEEEEE
5a2fA191207EE6.26798986.943500146.069597297.985763jmol
SeqFTCSVTYYGPSGQKTIH
SSEEEEEEEEEECCEEEEEE
1w1hA4870EE5.36201581.541606143.957232297.355312jmol
SeqILKMGPVDKRKGLFARRRQLLLT
SSEEEEEEEEEECCCCCCEEEEEEEE
3cwwA574592EE5.69641186.519308145.286310309.043026jmol
SeqLSYDLQNTIYGMYLSVKGY
SSEEEEEEEEECCEEEEEEEEE
1v9yA79102EE6.46663388.216351151.620077269.360508jmol
SeqKIWTRFALSKVSAEGKVYYLALVR
SSEEEEEEEEEEEEEECCEEEEEEEEE
1u14A7191EE6.08288684.710359144.900365287.240807jmol
SeqFWVAIEAGIDDDATFSWVVID
SSEEEEEEEEEEECCEEEEEEEEE
1r2qA4162EE5.70969179.997254147.615472292.599216jmol
SeqAAFLTQTVCLDDTTVKFEIWDT
SSEEEEEEEEEEECCEEEEEEEEEE
3iavA7895EE6.50983488.470073132.136267290.728922jmol
SeqVVTGYGTVDGRPVAVFSQ
SSEEEEEEEEECCEEEEEEEE
3wttB204225EE6.83358371.006779141.207786285.818405jmol
SeqKVYLKAPMILNGVCVIWKGWID
SSEEEEEEEEEEECCEEEEEEEEEE
4aefA224EE5.80207679.866724136.321655286.288357jmol
SeqYKLVSFRDSEIFGRVAEVEFSLI
SSEEEEEEEEEECCCEEEEEEEEEEE
3og6B148164EE5.32601588.719221144.903144307.946380jmol
SeqQNVTLLSQNFSVYLTWL
SSEEEEEEEEECCEEEEEEE
2btjA138159EE5.42678974.477688137.592146315.082059jmol
SeqSTEKMYVRDGVLTGDITMALLL
SSEEEEEEEEECCEEEEEEEEEEEE
3iagC205217EE5.07636389.591867138.991769308.022792jmol
SeqRYLHVEGGNFHAS
SSEEEEEEECCEEEEE
3c6aA5070EE5.17352188.921079140.316216302.628990jmol
SeqHALQIIDITEFPYKQVAVYHS
SSEEEEEEEECCCCCEEEEEEEEE
1cojA127144EE5.52366984.457434138.166457303.634428jmol
SeqWAILGLDIFSGRLVVNGL
SSEEEEEEEECCCCEEEEEEE
3vu4A5469EE6.31828083.209303145.460647313.094140jmol
SeqYVAFVTGVKEVVHIWD
SSEEEEEECCCCCEEEEEE
3sj5A156178EE6.32963681.722856147.703608299.119583jmol
SeqISVEEVERGEKDGFSRLKVRIKF
SSEEEEEEEEEEEECCEEEEEEEEEE
3fh1A84102EE6.25152588.747399151.478885312.647113jmol
SeqRATIRWRYWADGNSVRGVN
SSEEEEEEEEECCCCCCEEEEE
3s8mA153170EE5.09577087.151736137.631076293.800227jmol
SeqYTATAIDTNKDTIIQASI
SSEEEEEEEECCCCEEEEEEE
3a72A158181EE5.41890180.231120142.609788296.692357jmol
SeqKLICYYSDQRDNATYGQTMVHQVT
SSEEEEEEEEECCCCCCCCCEEEEEEE
4pmoA182202EE6.55576478.863083130.989671272.638481jmol
SeqLHQVEIDKRKVGGVGVDVNQI
SSEEEEEEEEEEEECCEEEEEEEE
4fvgA633EE5.38225275.643573143.652908274.770366jmol
SeqISFDIPPQEVLTKDSVTISVDGVVYYRV
SSEEEEEEEEEEEECCCCCEEEEEEEEEEEE
1epaA3554EE5.60373187.419408140.987478313.105687jmol
SeqGAMVVELKENLLALTTTYYS
SSEEEEEEEEECCEEEEEEEEEE
1dynA329EE5.91714083.650416142.893490295.853205jmol
SeqVIRKGWLTINNIGIMKGGSKEYWFVLT
SSEEEEEEEEEECCCCCCCCCCEEEEEEEE
4zj0A8198EE5.88953089.580945144.844832293.587721jmol
SeqHVKALVTWEGDVLVCVQK
SSEEEEEEEEEECCEEEEEEE
3zzyA3149EE5.68801987.081206145.856068301.496103jmol
SeqVLKIITFTKNNQFQALLQY
SSEEEEEEEEEECCEEEEEEEE
4dynA5778EE6.92902188.687016140.681133272.491719jmol
SeqKTGGPIYRRVDGKWRRELILYD
SSEEEEEEEEEEECCEEEEEEEEEE
4xohA331354EE6.27783577.607617143.018196288.809936jmol
SeqKVSFMFLDIPIEDIKKVSGTATLN
SSEEEEEEEEEEEECCCEEEEEEEEEE
2hdiB615643EE5.47632585.705648156.760098306.567405jmol
SeqGRSSTNHSIVVSGDPRFAGTIKITTSAVI
SSEEEEEEEEEEEECCCCCCCEEEEEEEEEEE
3be3A1536EE6.68364484.810762139.513694279.782195jmol
SeqHYLALGLARADETDEVVVVYTR
SSEEEEEEEEEEECCCCEEEEEEEE
5a10A199232EE6.15163168.926387141.923201300.828663jmol
SeqKLWVFYGFATANDPKIPTLYGSQDYESNRVHCYD
SSEEEEEEEEEECCCCCCCCCCCCCCCEEEEEEEEEE
4xhyA114141EE6.13674784.478916147.916013298.206566jmol
SeqARFDCAAHAAHEAGDHSVLIGRVLRVTV
SSEEEEEEEEEEEEEECCEEEEEEEEEEEEE
5boiA176202EE6.92024386.575527135.333135272.898139jmol
SeqKVMEERLAIITNDLNEEVLCYEFLGTI
SSEEEEEEEEEEEECCCCCEEEEEEEEEEE
3oh8A89108EE5.76049885.590617139.525986284.139201jmol
SeqRHVHNFVDQDGGTLITDSVS
SSEEEEEEEEEECCEEEEEEEEE
4p3hA5068EE5.40388086.600524148.827676308.022925jmol
SeqGWTLGLFQVSHGIFCTGAI
SSEEEEEEEEEECCEEEEEEEE
4o4aA78100EE5.55515988.531788152.235048297.151506jmol
SeqIHFSSTGSRTENSWEFPFANLEV
SSEEEEEEEEEEEECCEEEEEEEEEE
3x37B210227EE5.22574887.620886139.545249287.877653jmol
SeqHLLILHRKLKKVQCLKLN
SSEEEEEEEEECCEEEEEEEE
3k59A2037EE6.17793786.634178150.521099298.682602jmol
SeqGTEVSFWLATDNGPLQVT
SSEEEEEEEEEEECCEEEEEE
1uynX3470EE5.95479760.301936152.768780256.950791jmol
SeqLRVIAQTQQDGGTWEQGGVEGKMRGSTQTVGIAAKTG
SSEEEEEEEEEEEEEEEECCCCEEEEEEEEEEEEEEEEEE
5hg8A2548EE5.14464180.567295141.443085290.551805jmol
SeqGTVYKGLWIPEGEKVKIPVAIKEL
SSEEEEEEEEECCCCCCCCEEEEEEEE
5cxxA2443EE5.15987687.107645142.141765286.719555jmol
SeqAKKITYYSKVTETERKMNVI
SSEEEEEEEEECCCCEEEEEEEE
3oxhA99117EE6.61009684.980357147.489910308.288319jmol
SeqQVMMPAFDIGDAGRMSFIT
SSEEEEEEEEEECCCEEEEEEE
5innA96114EE5.82321680.551972146.681860299.634041jmol
SeqNLLCVNVSLGGNEFCLMTS
SSEEEEEEEEEECCEEEEEEEE
4gt4A2338EE5.47082784.856986139.024787298.382784jmol
SeqKVYKGHLFTQAVAIKT
SSEEEEEEEECCEEEEEEE
1f2tA6988EE5.69185488.940758150.478768310.835498jmol
SeqTYIDLIFEKDGTKYRITRRF
SSEEEEEEEEEECCEEEEEEEEE
4kliA257282EE5.41482089.220362136.538995311.095097jmol
SeqKFMGVCQLPSKNDEKEYPHRRIDIRL
SSEEEEEEECCCCCCCCCCCCCEEEEEEE
1ksiA453482EE5.51431787.662845156.347021285.858276jmol
SeqNSFEKTSLKTVRIKDGSSKRKSYWTTETQT
SSEEEEEEEEEEEEECCCCCCCCCEEEEEEEEE
5cl2A140167EE6.54985689.579579139.070570286.532021jmol
SeqFRLNEADCEQAPYFQRRLPFVQEFEFVP
SSEEEEEEEEEEECCCCCCCCCEEEEEEEEE
1x8qA4160EE6.41020877.282489143.561373300.595196jmol
SeqCAALAAGTASGKLKEALYHY
SSEEEEEEEEEECCEEEEEEEEE
4c47A89112EE5.71526988.810713145.401729272.430465jmol
SeqGLAGRILSIEPIDNGSVIHLDLVN
SSEEEEEEEEEEEEECCEEEEEEEEEE
2i4lA133167EE5.58732070.819084141.780809285.428928jmol
SeqLNLYHIQWKFRDEQRPRFGVMRGREFLMKDAYSFD
SSEEEEEEEEEEECCCCCCCCCCCCCCEEEEEEEEEEE
2ou5A3245EE5.22744579.670728139.914528308.490853jmol
SeqTLATIGTDGPDLRT
SSEEEEEEECCEEEEEE
4fgqA103122EE6.16073584.877339137.784491288.266391jmol
SeqLRITYAASLTLNQAHMVLSF
SSEEEEEEEEECCCCEEEEEEEE
3wcoA295325EE6.52945674.273337142.751866277.569164jmol
SeqLKISVIKDKAKPGGGSLPELELPTYCVAIRH
SSEEEEEEEEEEECCCCCCCCCCCEEEEEEEEEE
4e8yA2053EE6.03843682.133056141.872839277.092639jmol
SeqVMLDRYWFGNVDRISPEAPVPVVHVQRQEERLGG
SSEEEEEEEEEEEEEEECCCCCCEEEEEEEEEEEEEE
4g84A89115EE5.90911284.059672145.856679299.727245jmol
SeqIKRYHIAKVYRRDNRYREFYQCDFDIA
SSEEEEEEEEEEECCCCCCCEEEEEEEEEE
3ohsX208228EE6.62642885.729679154.480679314.454873jmol
SeqDDTVTVLLQYPGEVHGSFTCS
SSEEEEEEEEEEECCCEEEEEEEE
3pftA111138EE5.93350689.312853147.563306291.254922jmol
SeqVWLESAIEQLVPAGDHTIVVLRVSDIVI
SSEEEEEEEEEEEEEECCEEEEEEEEEEEEE
1kxoA5475EE5.15762172.464213142.269726268.358296jmol
SeqVKVSRYSVIHGKEYFSEGTAYP
SSEEEEEEEEEECCEEEEEEEEEEE
3ojiA120150EE6.15295887.157774146.278936271.029723jmol
SeqRSVTSVNEFVVLEKDKKKRVYSVVLESYIVD
SSEEEEEEEEEEEEECCCCCEEEEEEEEEEEEEE
4hceA99127EE6.49448179.057624142.871885267.288555jmol
SeqISVEVERILWDNDKTASPGMAVWSLKNIS
SSEEEEEEEEEEECCCCCCCCCEEEEEEEEEE
1vrmA319EE5.84894679.869025137.385354304.311921jmol
SeqYELRDFALGTSVRIVVS
SSEEEEEEEECCEEEEEEEE
1yreA143168EE6.53149787.378584132.292088255.447454jmol
SeqQREGVLRNHRRLAGGRLDDTFVYSIT
SSEEEEEEEEEEEECCCCCEEEEEEEEEE
2fgtA344362EE6.40587686.321956135.836214285.829247jmol
SeqIDQIFLAYQLLEPVWAMKV
SSEEEEEEEEEECCEEEEEEEE
3c9zA5470EE5.16827186.303726142.813977310.978006jmol
SeqKCMTANGLNNGSNIVIF
SSEEEEEEECCCCCCEEEEE
4pwsA127154EE5.64460587.086617157.317459290.434704jmol
SeqMTLNTSRRHVIATSGADKYLVSLSVTTA
SSEEEEEEEEEEEEEEECCEEEEEEEEEEEE
4n49A279304EE6.16305365.184632150.744686313.114192jmol
SeqFERVCLFKPITSRPANSERYVVCKGL
SSEEEEEEEECCCCCCCCCCCEEEEEEEE
4qa8A119142EE5.19039569.101591141.916416295.658322jmol
SeqQNPTIQGRDAIDGLATVKVSGTID
SSEEEEEEEEEEECCCCEEEEEEEEEE
3buuA107129EE5.40722784.499391148.608895283.252695jmol
SeqYHPQLLRNESIDDEDYYVLELTG
SSEEEEEEEEEEEECCEEEEEEEEEE
4i6nA151166EE5.78834289.201186150.413338304.222281jmol
SeqFHFVTYVPVNDGVYEL
SSEEEEEEEEEECCEEEEE
3e0hA122144EE7.02057477.420269149.792713314.379049
SeqEAYEIYLDNPAETAPDQLRTRVS
SSEEEEEEECCCCCCCCCCCCEEEEE
3greA100116EE6.65371179.170380147.462872311.384265
SeqVTQITMIPNFDAFAVSS
SSEEEEEEECCCCCEEEEEE
2auwA621EE6.78149082.209721151.647567311.139042
SeqLTAVEALAPYRLRTTW
SSEEEEEEECCCCEEEEEE
1h0hB10271046EE5.70709980.761991142.024325285.369260
SeqLVRMHEQEIDGRIDWLFFPD
SSEEEEEEEEEECCEEEEEEEEE
4gq1A317333EE6.50648081.406394156.195865312.452272
SeqIVDFCWHQDGSHLAIAT
SSEEEEEEECCCCCEEEEEE
4qenA376387EE6.51518974.256031144.456643316.712772
SeqIFEIDCPEFCID
SSEEEECCCCCEEEE
5igoA294310EE6.36726179.291015153.592474313.866312
SeqISAVCWKSDSPTMLTAN
SSEEEEEEECCCCCEEEEEE
3facA7691EE6.86844379.011108149.110533316.502786
SeqYTHHQRRSNPEEYGVN
SSEEEEEECCCCCCEEEEE
1jz8A209235EE5.79909178.962866157.169656303.505469
SeqQISDFHVATRFNDDFSRAVLEAEVQMC
SSEEEEEEEEEEEECCCCCEEEEEEEEEEE
3rghA5167EE6.78686381.287022147.612762313.790235
SeqEVYIQDHGDGTHTITYI
SSEEEEEEECCCCEEEEEEE
3wqcA360374EE5.72990676.347346144.619760314.284383
SeqAYQALAADGSVQTWE
SSEEEEEECCCCEEEEEE
3oblA99119EE6.71857680.478809139.457453308.441272
SeqVVAINVESGDDGQTLNGTMTY
SSEEEEEEEECCCCCCEEEEEEEE
1qksA292308EE6.86107678.773372155.540156307.124965
SeqVAAILASHYRPEFIVNV
SSEEEEEEECCCCCEEEEEE
4v1tA563585EE5.96561976.164591150.844710311.894971
SeqRDLWVLDLTADLGIPAFAGVSNR
SSEEEEEEEECCCCCCCCEEEEEEEE
5c0pA3553EE6.69783159.713380137.724614289.560817
SeqIRVYKSKDLSTWKDEGYSF
SSEEEEEECCCCCEEEEEEEEE
2e4mC630646EE6.11099571.314276155.349713301.714766
SeqEPNKYLAYNDYGFIYLS
SSEEEEEEEEECCCCEEEEE
2o3iA295334EE6.05880869.034811153.226762312.557475
SeqAISYFVEGEGQHVFSNGDLSGNDHGLDPSVRGRKAAVIAL
SSEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEE
2vwiA620EE6.15678484.241819140.828519314.073929
SeqELQEVIGTAVVQAAY
SSEEEEEECCCCCEEEEE
2yfoA103138EE6.46067067.038490153.199426306.072781
SeqLFKSYEIRNGKYRLQGLPAVWADEKEAQTLEIVLAD
SSEEEEEEEEEECCCCCCCCCCCCCCCCCEEEEEEEEEE
2ar0A291319EE6.47541377.910635154.973076313.120739
SeqCHLHTILRLPTGIFYAQGVKTNVLFFTKG
SSEEEEEEEEECCCCCCCCCCCCEEEEEEEEE
3rrsA748757EE6.31385273.790437156.819491315.922928
SeqVRPEYDGLVV
SSEEEECCCEEEE
3pe7A124145EE6.31880887.691682145.960831308.889612
SeqWVGYGTWVANSDCTKLVGIEIR
SSEEEEEEEEEECCCCCEEEEEEEE
1oheA719EE6.78667373.900102145.995328316.663407
SeqVYLDITDRLCFAI
SSEEEEECCCCEEEEE
3sxxA137163EE6.05424476.195997142.906324296.358604
SeqVYCDPWTIGYDERWGTGKRLQQALVYY
SSEEEEEEEECCCCCCCCCCCCEEEEEEEE
1z5hA417434EE6.57182080.997023150.409944302.968850
SeqPVIKLKRNGRKITMYQTR
SSEEEEEEEECCCEEEEEEEE
4g6dB105120EE5.98258481.044398143.890723309.170209
SeqYEYKLSRNGEYLELKR
SSEEEEEECCCCCEEEEEE
1nwzA103124EE5.27346265.714324152.872135302.970572
SeqTKVKVHMKKALSGDSYWVFVKR
SSEEEEEEEEEECCCCCEEEEEEEE
1wsuA118128EE6.55723478.743310142.483642314.913594
SeqLVKINDEFYWH
SSEEEECCCCEEEE
5hqgA293313EE6.96871780.765352151.562536308.979764
SeqVSAVCWRALPDGESNVLIAAN
SSEEEEEEECCCCCCCCCEEEEEE
3c9zA180200EE5.95072661.621122155.760379308.329689
SeqTRGLCVTTNGYNSKDLIIILK
SSEEEEEEEEECCCCCCCEEEEEE
2bo9B465493EE6.61908787.030958146.370768288.324763
SeqYKMVKIQTVKQVQRNDDFIELDYTILLHN
SSEEEEEEEEEEEEECCCCCCEEEEEEEEEEE
5ij8A397407EE6.67410379.302326140.989227314.911452
SeqLFNLNNDFVVD
SSEEEECCCCEEEE
4g79A99116EE6.75092076.558453152.159812315.433918
SeqEINIILDAEKNFCSFELF
SSEEEEEEECCCCCEEEEEEE
4lg8A159175EE6.59892475.616118158.736011310.365865
SeqLTCAQFHPDGLIFGTGT
SSEEEEEEECCCCCEEEEEE
2qn6B432451EE6.91808173.881432152.189534309.390933
SeqLLNIKIYTIGAPRYRVDVVG
SSEEEEEEEEECCCCEEEEEEEE
2xhiA5369EE6.71146181.807993154.463426309.741460
SeqQVWTLTQTEEQLHCTVY
SSEEEEEEEECCCEEEEEEE
1tulA523EE6.23211080.253683139.770647295.691296
SeqIIVNAQINSEDENVLDFII
SSEEEEEEEECCCCCCEEEEEE
1u7bA87104EE6.53706875.296913157.642197316.645401
SeqIITLRAEDNADTLALVFE
SSEEEEEEECCCCCEEEEEEE
1vprA252270EE6.51106874.084467154.768837311.233144
SeqRKIGFFWEESGRCFRIERR
SSEEEEEEEECCCCEEEEEEEE
3qk8A822EE6.76688176.275736150.716438314.711982
SeqLRFEPGEHGVLNLVL
SSEEEEEECCCCEEEEEE
1ggpB248266EE5.62317465.719523145.169792305.441444
SeqFCADVNGEGQNGAAIILKK
SSEEEEEECCCCCCCCEEEEEE
1pueE137148EE6.58896176.355968143.735117314.852199
SeqVKKVKKKLTYQF
SSEEEECCCCCEEEE
3bh0A234261EE6.58589385.338740152.573066307.763005
SeqIIEFLYRDDYYDKESESKNIVEVIIAKH
SSEEEEEEEECCCCCCCCCCCCEEEEEEEEE
2zw5A6179EE6.90033872.371992153.599249316.577767
SeqRLWTIRAPDGTVPGMAGLL
SSEEEEECCCCCCCCCEEEEEE
1o70A113132EE6.82889281.878363138.273958273.037898
SeqVNATVIQADVAQTNGYVHII
SSEEEEEEEEEEEECCCEEEEEE
1px5A4869EE6.76005559.866586153.463746294.256081
SeqRVSKVVKGGSSRSDADLVVFLT
SSEEEEEEEEEEECCEEEEEEEEEE
3ow8A109123EE6.01127475.691564158.849156315.431031
SeqYLATGTHVGKVNIFG
SSEEEEEECCCCEEEEEE
4agiA224240EE6.07304376.589810153.512097303.973496
SeqSIYMRIYFVNSDNTIWQ
SSEEEEEEEEEECCCCEEEE
1ofzA7393EE5.84074963.367834154.771656302.247276
SeqGIQIRVYCVNKDNILSEFVYD
SSEEEEEEEEEECCCCEEEEEEEE
1k8kC612628EE6.66031681.511842141.183473313.174702
SeqQIAICPNNHEVHIYEKS
SSEEEEEECCCCEEEEEEEE
4q51A191211EE6.25492364.354757143.214536307.859447
SeqADVDRCHYFKADELYLFVWRE
SSEEEEEEEEEECCCCEEEEEEEE
3oblA3252EE6.74719079.051302140.053524308.642151
SeqVVAINVESGDDGQTLNGTMTY
SSEEEEEEEECCCCCCEEEEEEEE
4pxwA1733EE6.07007477.920691146.631994309.508187
SeqFTCCAFSARERFLMLGT
SSEEEEEEECCCCCEEEEEE
1jr7A723EE6.77433182.156126143.477830310.860017
SeqFTLTPSAQSPRLLELTF
SSEEEEEECCCCCCEEEEEE
5fa1A154174EE6.23938271.207564154.241948314.555743
SeqVMHIEIGPLRAPMYRNTAYLD
SSEEEEEEECCCCCCCCCCEEEEE
2qyuA369383EE6.83645178.538760143.262208315.638972
SeqFLLLSSQDSDTAMML
SSEEEEECCCCCCEEEEE
2a1vA7792EE6.67459080.056670139.743206316.305837
SeqIAPGYHLNKKHWVTVT
SSEEEECCCCCCCCEEEEE
3holA321342EE6.36510067.671759140.997417305.705404
SeqKTMVAVACCSNLEYMKFGQLWQ
SSEEEEEEEEECCCCCCEEEEEEEE
4o6aA7894EE6.47135689.183038131.771459307.241398
SeqIELQEYYETGAFYLVKF
SSEEEEEECCCCCCEEEEEE
4ckmA101122EE5.57952674.759604151.857795306.767203
SeqYELSFVLNSGDSNRGTLRVLET
SSEEEEEEEECCCCCCEEEEEEEEE
1zelA6374EE6.64621486.786942131.354928313.944373
SeqLVQLPVKGTWAF
SSEEEECCCCCEEEE
4pwyA1224EE6.25615075.215627153.614779316.440654
SeqFSVTEGAWVQYTS
SSEEEEEECCEEEEEE
4pyrA274287EE5.28146981.233027144.912176314.608201
SeqGDLKLGRDRAFERQ
SSEEEEEECCCCEEEEE
5fr8A381412EE6.62968378.147871154.821784286.879762
SeqKMESRIASAYIEDNLKVTDSTDVVLGLRFDDH
SSEEEEEEEEEEEEEEEEECCCCEEEEEEEEEEEE
2aydA4866EE6.43153075.734423154.391221315.633153
SeqKKHVERSSHDTKLLITTYE
SSEEEEEEECCCCCCEEEEEEE
5fxuA96119EE5.45151769.747683154.556702297.527170
SeqKTIACFDLSCNQTACQPTVFLIGP
SSEEEEEEEEEEECCCEEEEEEEEEEE
4cs6A2851EE6.48043673.953276147.947445315.427659
SeqAIHLYGSAVAGGLKPNSDIDLLVT
SSEEEEEECCCCCCCCCCCCCEEEEEE
3w15A307325EE6.42329678.774146152.655539314.833543
SeqVFGADWSLWGKPGYVASTA
SSEEEEEEECCCCCCCEEEEEE
2r3aA179192EE6.47897573.448172145.695200316.636602
SeqLFDLDYESDEFTVD
SSEEEECCCCCCCEEEE
1j98A7190EE6.84786182.588164146.023848303.251097
SeqFDIIDISPMGQTGYYLVVSG
SSEEEEEEEEECCCCEEEEEEEE
3rt2A5070EE6.38740981.790826148.354797316.119048
SeqISRCVVQGKKLEVGSVREVDL
SSEEEEEEECCCCCCCCCEEEEEE
2z3zA358375EE6.37679283.282083147.940130314.987471
SeqMHRTQLSPDGSAIIDIFQ
SSEEEEEEECCCCCEEEEEEE
4revA102126EE6.85092479.575686157.713084302.498832
SeqRGIATITTDAFEAYFRLGVYIKFFE
SSEEEEEEEEEEECCCEEEEEEEEEEEE
4puiA2144EE6.97691281.816194151.158429313.900153
SeqELEVEDVSYQHADDGETHFNLRIV
SSEEEEEEECCCCCCCCCCCEEEEEEE
5hnmA134157EE6.43320084.636301140.217627316.136195
SeqFIRRYPPDKTEITGVSNEPWHYRY
SSEEEECCCCCCCCCCCCCCCCCEEEE
1e5xA2656EE6.77911282.049816131.621419301.559882
SeqAKYVPFNAAPGSTESYSLDEIVYRGLLDVEH
SSEEEEEECCCCCCCCCCCCCCCCCCCCEEEEEE
3ot9A147162EE6.27350880.783029141.844127315.936910
SeqLIVYTSADSVLQIAAH
SSEEEEEECCCCEEEEEEE
1sr4A3047EE6.80903374.785688141.489836300.217227
SeqALLTVWALAKRNWLWAYP
SSEEEEEECCCCCCCEEEEEE
5c2vA7697EE5.24579289.190786143.993375305.687042
SeqFATAFDPCTYWDGKKFAFAGVH
SSEEEEEEEEEECCCCCEEEEEEEE
4hvtA110131EE6.24648789.390872145.696815304.668257
SeqVAYRGVSNCFQNPNRYLISMSF
SSEEEEEEEEECCCCCCEEEEEEEE
2zxiA288304EE6.68227079.999083142.510828311.256734
SeqQIFLEPEGLDTIEIYPN
SSEEEEEEECCCCCCEEEEE
5ij7E11721187EE5.87619174.737773150.650708316.652108
SeqLILSKSCENAIVCWKP
SSEEEEEECCCCEEEEEEE
4p37A116131EE6.61499175.649132145.506019314.366873
SeqVQGKEAQHEETYSIFV
SSEEEEEECCCCCEEEEEE
3phzA1834EE5.19344065.119300150.369720309.948766
SeqTRLALSENKSPDVIISS
SSEEEEEECCCCCCEEEEEE
3q6kA222242EE6.16073281.107969156.696731311.368118
SeqIFGITLGDRDSEGNRPAYYLA
SSEEEEEEECCCCCCCCCEEEEEE
2gmhA269290EE6.89879178.978945156.345741312.619186
SeqGGSFLYHLNEGEPLLALGFVVG
SSEEEEEEEECCCCCCEEEEEEEEE
4m5dB11261148EE5.74368682.238034142.388881314.041600
SeqLHFMFAKRHQSSNSNESDCLFLV
SSEEEEEEEEECCCCCCCCCCEEEEE
4o5vA176190EE6.88030669.747185144.955410302.531792
SeqDIKIESVKDTVRVLV
SSEEEEEEECCCEEEEEE
3r9fA818EE6.53422477.275109146.942119313.486598
SeqGIKVNDEITLL
SSEEEECCCCEEEE
5ar2A1530EE6.65662088.780076143.508730312.928921
SeqLADLRYLSGTVSSARH
SSEEEEEEECCCCEEEEEE
1q2lA569586EE7.02610976.453883148.482974309.868179
SeqISFSTNANNGLMVNANGY
SSEEEEEEEECCEEEEEEEEE
2p4oA115130EE6.12479880.986659143.486051311.351156
SeqLNGITPLSDTQYLTAD
SSEEEEEEECCCCEEEEEE
1txdA300316EE6.78653681.807590149.913917314.082430
SeqVLVRQVATNKALFVISM
SSEEEEEECCCCCEEEEEEE
3vl1A290307EE6.60753879.558820152.193758312.721788
SeqCNSLTVDGNNANYIYAGY
SSEEEEEEECCCCCCEEEEEE
1qfhA6174EE7.00371379.580597149.725269313.686741
SeqKVTDNNDGTYGVVY
SSEEEEECCCCEEEEEE
1no5A2447EE6.50913677.995855142.035536311.403886
SeqTVWAFGSRVKGKAKKYSDLDLAII
SSEEEEEECCCCCCCCCCCCCEEEEEE
1jlyA219233EE5.23179871.018602148.281564310.087707
SeqKFWRLSTDDWILVDG
SSEEEEEECCCCEEEEEE
2okcA308335EE6.55646878.493718153.239548313.935843
SeqFNLHTILRLPTGIFYAQGVKANVLFFSK
SSEEEEEEEEECCCCCCCCCCCCEEEEEEEE
5j92A417EE6.58354778.397533137.663959314.701691
SeqNVEAAHPFIAARIH
SSEEEEECCCCCEEEEE
4n1iA144162EE6.32800974.126227155.971579311.171051
SeqKVYLFFVADNGKVYRTSMA
SSEEEEEEEECCCCEEEEEEEE
3taiA200211EE6.94240483.910633131.720227315.992976
SeqVIAYGSGKVKVK
SSEEEECCCCEEEEE
4m5dA10651075EE6.15371882.530932135.993152315.062666
SeqVKPVDDENVIL
SSEEEECCCCEEEE
3ojiA6182EE6.55687083.105074152.537686312.201458
SeqIKSCTIRVNKEIKVGTIREVSV
SSEEEEEEECCCCCCCCCCEEEEEE
4f14A2339EE6.14959285.957293144.881460315.545262
SeqYIVNVQPIDDGWMYGTV
SSEEEEEEEECCCCEEEEEE
4oujA1330EE6.52553869.510753152.296607301.994541
SeqNTDLFFYQVPGNGNVSLF
SSEEEEEEEEECCCCCEEEEE
3leqA6580EE6.74085782.709579144.055669311.856871
SeqLILTAAGPGAHLVVLT
SSEEEEEECCCCEEEEEEE
1xipA213230EE6.71643785.930907151.075162310.054537
SeqSPLSVTILSPQDFLAVFG
SSEEEEEEEECCCCEEEEEEE
1zpsA7090EE5.58967681.259896151.354791312.741728
SeqQRVKDVLVDCDGDAVVLKVEQ
SSEEEEEEEEECCCCCEEEEEEEE
1mkfA328343EE5.98441569.204911142.781646312.515306
SeqIRLVEGQSQNVLQVRV
SSEEEEEECCCCCEEEEEE
3optA6986EE5.66371074.438220155.607972312.423260
SeqIQQHISGNKGLFMVQNVE
SSEEEEEEEECCCEEEEEEEE
3greA244265EE6.12048382.036175146.078946303.385968
SeqAPITHVEVCQFYGKNSVIVVGG
SSEEEEEEEEECCCCCCCEEEEEEE
2o8rA169185EE6.82891978.930878140.816464308.395813
SeqFVELPRLQTDTFYYYSF
SSEEEEECCCCCCCCEEEEE
4ifdI23192329EE6.71331684.240337139.444623313.941918
SeqLMYATDWQMMT
SSEEEEECCCCEEE
2eceA243267EE5.28794475.655844149.940839308.531908
SeqNRMALELRPLHDPTKLMGFINMVVS
SSEEEEEEEEEECCCCCCCEEEEEEEEE
3nbcA4964EE6.12382881.929267143.186721314.394854
SeqWTLVQLPHTTIYTMQA
SSEEEEEECCCCCEEEEEE
5hd3A102123EE5.32445165.643292152.701845302.811037
SeqTKVKVHMKKALSGDSYWVFVKR
SSEEEEEEEEEECCCCCEEEEEEEE
4fpwA5062EE6.94999365.640191129.281760312.215824
SeqPKGDLREGGNFAL
SSEEECCCCCCCEEEE
1xksA248272EE6.62365675.890583155.186678301.894066
SeqGLVILAAAWHSADNPCLIYYSLITI
SSEEEEEEEEEECCCCCCCEEEEEEEEE
1btnA6279EE6.77457774.140558149.898990315.557527
SeqICEVALDYKKKKHVFKLR
SSEEEEECCCCCCCCCEEEEE
2oizA382399EE5.87504373.365617142.819171310.408381
SeqCWSVIPQPNRPRSFMTIC
SSEEEEEEECCCCCCEEEEEE
3moiA304317EE6.54423776.334483148.227288314.781688
SeqADLRASPEGVLVYG
SSEEEEEECCCEEEEEE
3w6sA112136EE6.16311074.971381148.489572305.339436
SeqLLGTFYIKPNYAPRCSHNCNAGFLV
SSEEEEEEEEEECCCCCCCCEEEEEEEE
4p72A435447EE6.77900384.536644134.881713312.300265
SeqTVVADGEGQWSVG
SSEEEEECCCCEEEEE
3f8xA6481EE6.29230180.869017155.257761315.003159
SeqQYARHFSSKSGYVLEFNA
SSEEEEEEEECCCEEEEEEEE
3biqA359397EE6.92462184.073001153.163028301.710244
SeqGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNL
SSEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEE
5hpzA96113EE6.34996974.516954151.260759316.186007
SeqLWAVDVSSSAAKEPAIII
SSEEEEECCCCCCCCCCEEEE
1q47A92108EE6.46449078.881921147.924503304.643736
SeqFIKVLEAYNQTHLYACG
SSEEEEEEEECCCCEEEEEE
3mcbB6377EE6.73789879.356948149.967353315.423430
SeqEVNMFTNQGTVIHFN
SSEEEEEECCCCEEEEEE
2pbiB473489EE6.49381880.202310152.973533314.244786
SeqVLCMDWCKDKRRIVSSS
SSEEEEEEECCCCCEEEEEE
4m0qA2133EE6.89446278.611506146.610516315.198700
SeqLVSQTIQGWKVYW
SSEEEEECCCEEEEEE
1pguA6684EE6.38378376.875794153.521130315.568789
SeqVTTVKFSPIKGSQYLCSGD
SSEEEEEEECCCCCCCEEEEEE
4l7gA278295EE6.22420177.809923148.488162308.783530
SeqISLYLMGEVTNQSFRITI
SSEEEEEEECCCCCEEEEEEE
2bjuA274287EE6.35398384.346190131.392957316.458641
SeqLQHIEDVGPGLCML
SSEEEECCCCCCCEEEE
5cqgA135150EE6.23792076.940986143.498571311.579718
SeqYKPIKTLNGHEIKFIR
SSEEEEEECCCCCEEEEEE
2z3zA226245EE6.22218869.489809152.140800310.077757
SeqILYVAEVNRAQNECKVNAYD
SSEEEEEEEECCCCCEEEEEEEE
4j2kA93106EE5.78186273.757235152.920114314.347906
SeqLPWKVEGESQEVKI
SSEEEEEECCCCCEEEE
1wwcA4967EE7.00235276.540535147.290237303.780222
SeqIHVEYYQEGEISEGCLLFN
SSEEEEEEEECCCEEEEEEEEE
3f7fA140155EE6.61565969.534734156.038278314.780207
SeqPHFLFYVSPQFSVVFL
SSEEEEEEECCCCEEEEEE
5ce6A345383EE6.67736188.599711148.597473296.570601
SeqGTGIGIEFRESGLNINAKNDQIVKEGMVFNVSLGFQNLH
SSEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEEE
4lm8A7080EE6.45477776.223285153.892399314.298836
SeqYVDNKNGSYTF
SSEEEECCCCEEEE
1g8aA316EE6.87104981.406016136.677486314.513137
SeqEVKKHKFPGVYTVI
SSEEEEECCCCCEEEEE
5ehaA91105EE6.56834380.521601138.131241311.348381
SeqWSIEYSGNGEEFWIR
SSEEEEEECCCCCEEEEE
2bi0A105127EE5.19140573.896995153.186435312.317265
SeqTEVVGLRANSPKPGRAPTGLAGL
SSEEEEEEEEECCCCCCCCCEEEEEE
4cu4A446480EE6.54159679.510004148.675615295.499529
SeqTTDKRDDKQFTWRGGVNYLFDNGVTPYFSYSESFE
SSEEEEEEEEEEEEEEEEEEECCCCCEEEEEEEEEEEE
4nlmA285296EE6.48516680.760813146.194009314.540293
SeqILSYETGDLVLY
SSEEEECCCCCEEEE
4j0wA253268EE7.01206577.410106156.495492306.471760
SeqLVATGSHSSCVRLWQC
SSEEEEEECCCCEEEEEEE
3gygA180204EE6.87659685.611946148.778776304.611655
SeqVSVNINRCNPLAGDPEDSYDVDFIP
SSEEEEEEEECCCCCCCCCCEEEEEEEE
4nsxA323340EE6.99082084.697357151.551712305.517170
SeqPSYIAFADSQSHFMLSAS
SSEEEEEEECCCCCCEEEEEE
4czxA114131EE5.93004380.971651148.458316310.593704
SeqLRAMSFTSKGTSEILVAG
SSEEEEEEECCCCCCEEEEEE
4alzA8299EE6.60801076.155933143.740875315.841010
SeqIEVSLAPQAGWLQLNGEV
SSEEEEEECCCCCEEEEEEEE
4gkhA1027EE6.72117877.156380139.914356307.705480
SeqRWARDNVGQSGATIYRLY
SSEEEEEECCCCCCCEEEEEE
3dnsA723EE5.79237175.122219145.757606316.508846
SeqTKIEKVNGVEREYLITD
SSEEEEEECCCCCCEEEEEE
2aj7A4259EE6.15792369.910403146.533435314.247506
SeqEFVLLPFAAGTPYYTLQS
SSEEEEEEECCCCCCEEEEEE
2r2zA6078EE6.98509983.770835145.669353312.025843
SeqIKLTAEEEGTRLLVLRVHF
SSEEEEEECCCCCCCCEEEEEE
1cjaA5674EE6.21040676.502904150.301770316.300251
SeqFKGIERSEKGTEGLFFVET
SSEEEEEEECCCCCCCEEEEEE
2pd1A3857EE6.58764560.347736156.750341313.751235
SeqTTAWFALKFGPSTFGVFDAF
SSEEEEEEEEECCCCEEEEEEEE
1k3iA194219EE5.99292376.735058155.500954315.620025
SeqRVLMWSSYRNDAFGGSPGGITLTSSW
SSEEEEEEEECCCCCCCCCCCCEEEEEEE
1k32A369385EE6.62952580.771877154.443738310.845486
SeqVFAMGVDRNGKFAVVAN
SSEEEEEEECCCCCEEEEEE
3d8kA2335EE6.73878670.482263154.562753313.619457
SeqRPTSESDDVVVVE
SSEEEEECCCEEEEEE
1r44A175187EE6.37594181.811764138.577650314.797454
SeqFEAYSLEWWHYVL
SSEEEECCCCCCEEEE
4puhA1837EE6.66231181.856675151.429259316.568845
SeqHLEVIDISGGCGSSFEVEVV
SSEEEEEEECCCCCCCEEEEEEE
4lg9A148163EE6.40483178.238644150.113268314.001555
SeqALDVDWQSNNTFASCS
SSEEEEEEECCCCEEEEEE
5a1jA516EE6.74976982.870259144.413232314.284742
SeqSMSDEGDSFLVK
SSEEEEECCCEEEEE
3vu4A4558EE6.71629473.656575153.711945314.663374
SeqKVRMLHRTNYVAFV
SSEEEEECCCCCEEEEE
4u6dA105124EE6.39085088.826591141.288553293.119766
SeqEIWYATSKDGFTWEEQGVAV
SSEEEEEEEECCCCEEEEEEEEE
1upiA215EE6.49351381.183318140.113994315.866080
SeqKARELDVPGAWEIT
SSEEEEECCCCCEEEEE
2aeuA280297EE6.54277571.374056153.472745313.110246
SeqINIVYERTPTGFVIKRVY
SSEEEEEEEECCCEEEEEEEE
2dc4A2449EE6.89418985.570202130.322367284.434780
SeqKFFGIEEQEDVYFELPSPKLLRVRKI
SSEEEEEEEEEEEEEECCCCCEEEEEEEE
5igoA155172EE6.46246581.321015152.693842315.076368
SeqICCVKYNPGSSNYIAVGS
SSEEEEEEECCCCCCEEEEEE
1pguA528548EE6.94192082.201357153.173334307.169945
SeqINAISWKPAEEIEEDLVATGS
SSEEEEEEECCCCCCCCCEEEEEE
3dteA223239EE6.46623177.997226151.522394313.359442
SeqAYVDAFPERQRVLVSFA
SSEEEEEEEECCCEEEEEEE
5igeA421EE5.82496378.232508154.792674316.567487
SeqEPATLIKAIDGDTVKLMY
SSEEEEEEEEECCCCEEEEEE
3pmeA272298EE6.67491775.510297142.894052306.542114
SeqITIKSAANKNPYSRILNGDDIMFHMLY
SSEEEEEECCCCCCCCCCCCCCEEEEEEEE
2bklA120140EE5.56404583.441397156.426950314.583180
SeqVSLGTWAVSWDGKKVAFAQKP
SSEEEEEEEEECCCCCEEEEEEEE
4izxA6278EE5.59421663.900339142.965489315.322492
SeqYLGIEGTPADGTRLVAV
SSEEEEECCCCCCCCEEEEE
4murA136159EE6.43597984.791027137.191576315.295309
SeqFILRYPEDKQEITGISYEPWHFRY
SSEEEECCCCCCCCCCCCCCCCCEEEE
5efrA6383EE6.43761775.002973158.012694310.077967
SeqRAEPTIRVVGGDSLDLHFDVY
SSEEEEEEEEECCCCEEEEEEEEE
5haxA428466EE6.55053678.580280147.669169311.206994
SeqTIEIGLTTAPFAAAKQPLGFGNELAVQFDQVPGEFAVLT
SSEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEE
2hiyA124137EE6.89339376.630799158.939175308.503289
SeqEVLYFGKLGIFWGK
SSEEEEEECCCEEEEEE
3s28A327341EE6.98283083.978315143.951573315.916483
SeqLERVYDSEYCDILRV
SSEEEECCCCCCEEEEEE
5chxA1336EE6.00470188.088241142.938755310.453692
SeqEPSITHFLQVSWETLESGFVITLT
SSEEEEEEEEEEEEECCCCCEEEEEEE
2xp1A123141EE6.64409171.751908151.019815310.784332
SeqVYAFYFSRKYPGKLTFAYN
SSEEEEEEECCCCCCEEEEEEE
4fu0A7086EE6.09881782.017814140.343726313.197417
SeqLCPVVVSQNRSVKGFLE
SSEEEEEEECCCCCCCEEEE
4gafB224242EE5.33243269.033774153.856498310.017949
SeqGHYYCVVYCLRIKISAKFV
SSEEEEEEECCCEEEEEEEEEE
4ylfA825EE6.25940779.819237154.315150315.959105
SeqEIVKKVKIAEDVFDFWIH
SSEEEEEEEECCCCEEEEEEE
4ds2A3249EE5.93887480.172278151.847388316.427366
SeqAIFSVDTDTIYNWILKVK
SSEEEEEEEECCCCEEEEEEE
3lhnA2646EE6.72737278.430455154.376388312.716705
SeqGIQTTLTLQADNSFELKSIYL
SSEEEEEEEEECCCCEEEEEEEEE
2oyrA222235EE6.91766374.451553155.653704313.256870
SeqNAVVTKGHRFDIYA
SSEEEEECCCEEEEEEE
4oagA82102EE6.53137985.537058137.042438309.352803
SeqWSCIPGEDTIMNVPGFFLVRR
SSEEEEEECCCCCCCCCCEEEEEE
4tr6A360374EE6.93637679.057851148.188635313.956842
SeqFLIRTPNDETIVQLI
SSEEEEECCCCCCEEEEE
3p26A234256EE5.75426575.694046155.175987314.751060
SeqLFSVLEIIPTSNDLALVSGKLES
SSEEEEEEEEECCCCCCEEEEEEEEE
1jlyA1635EE5.71207170.462358148.424045306.128077
SeqKYLRYQSDNIQQYGLLQFSA
SSEEEEEECCCCCCCCCEEEEEE
4ndhA2846EE6.73019080.422209140.536297309.892683
SeqVVVIKDKYPKARYHWLVLP
SSEEEEEECCCCCCCCEEEEEE
3mi9A1231EE5.46042686.944350144.351618315.031051
SeqYEKLAKIGQGTFGEVFKARH
SSEEEEEEECCCCCCCCEEEEEE
2va8A204222EE6.83001585.993121137.813804295.922113
SeqLIEGVIYPERKKKEYNVIF
SSEEEEEEEEECCCCCEEEEEE
4fs7A824EE5.92277587.585695136.344140301.215351
SeqITYNFTKEHGTVEVSGL
SSEEEEEECCCCCEEEEEEE
1u3eM7588EE6.46588177.576715141.896490315.750298
SeqWKDIKGYEGHYQVS
SSEEEECCCCCCCEEEE
4q5eC267284EE6.60401875.236286157.947981315.730519
SeqFRNIQVDEANLLTWQGLI
SSEEEEEEECCCCCCEEEEEE
5ikcM901926EE6.59647778.398839140.783829314.847551
SeqYIYTIDGSRKIGSMDELEEGESYVCS
SSEEEEECCCCCCCCCCCCCCCCCEEEEE
1y12A90128EE6.80611465.846610157.080745300.602242
SeqLIITLKEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDY
SSEEEEEEEEEEEEEEECCCCCCCCCCEEEEEEEEEEEEEEE
4likA155169EE6.35114172.171040149.683632316.419222
SeqRLWVYSGRRGVHCWV
SSEEEEEECCCCEEEEEE
2b4vA168186EE6.42219782.911435155.402754311.291165
SeqVEGIRVDRTTYGCRIAIQC
SSEEEEEEEEECCCEEEEEEEE
4gqbB733749EE6.30697174.768439153.832896315.266864
SeqVSTVSVLSSGTQAVSGS
SSEEEEEEECCCCCEEEEEE
3gonA286303EE6.92746276.624708152.492629311.344522
SeqAVAKSSGAGGGDCGIALS
SSEEEEEECCCCCCCEEEEEE
2p9wA295320EE6.28010477.718982156.286331314.192264
SeqEQGLYAVSAFFDNGAHGGRSDYPLYK
SSEEEEEEEEECCCCCCCCCCCCCEEEEE
1ei5A356370EE6.66401985.141364136.798302308.094481
SeqVLSLEDAGHGRMKAR
SSEEEEEEECCCCEEEEE
3ju4A193205EE6.53297777.375483153.029807316.633059
SeqITKAANQRYATIH
SSEEEECCCCCEEEEE
3bl9A152174EE6.28593775.050817143.793455313.226233
SeqFVLIPDLKWNQQQLDDLYLIAIC
SSEEEEEECCCCCCCCCCCCEEEEEE
3ut2A658674EE5.87233275.306386144.841474313.199403
SeqIAWTASGADGESWVGTD
SSEEEEEECCCCCCEEEEEE
1j7xA240255EE6.40438471.459231148.117090313.556220
SeqSKVFPFGDTQLSVTVP
SSEEEEEECCCCCEEEEEE
1olzA88104EE6.87208885.913242142.231138303.029065
SeqYIRVLQPLSATSLYVCG
SSEEEEEEEECCCCEEEEEE
4ft4A766809EE6.12321370.282400138.199433289.167745
SeqHYFTCRWFFRAEDTVINSLVSISVDGHKHDPRRVFLSEEKNDNV
SSEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEEE
4kikA327360EE6.85171885.308651136.870129312.660447
SeqLLQEAGLALIPDKPATQCISLNEGHTLDMDLVFL
SSEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEE
1wznA218241EE6.12139170.486414152.490523316.445407
SeqKVKIYGNLKRELSPNDMRYWIVGI
SSEEEEEEECCCCCCCCCCCEEEEEEE
2cvhA178197EE6.27765572.485039154.439591309.309167
SeqDILRLDKLPKPGLRVAVLER
SSEEEEEEEECCCCCEEEEEEEE
3a99A625EE6.60631267.450085145.573679307.381094
SeqYQVGPLLGSGGFGSVYSGIR
SSEEEEEEECCCCCCCEEEEEEE
2qdfA206228EE6.36836286.664969148.853325306.850968
SeqNIDSTQVSLTPDKKGIYVTVNIT
SSEEEEEEEEEECCCCCEEEEEEEEE
4jqrA3150EE6.12457074.839573147.828202304.092370
SeqQETDFKDPKNLINFNHYYAD
SSEEEEEEECCCCCEEEEEEEEE
3hx6A93113EE5.07661261.173033152.930716303.501915
SeqAWHTVLIGSLRAGGKGLFALD
SSEEEEEEEEEECCCCCCEEEEEE
5fbyA3251EE6.11693374.609801153.501824309.615639
SeqWHVISLSLSDGGHDLCITRL
SSEEEEEEEEECCCCCEEEEEEE
4gq2M164179EE6.81117278.502073150.090853309.047537
SeqPDLMAAISTSEICVSF
SSEEEEEEECCCCEEEEEE
1mscA4364EE6.45024972.872236150.718311310.797652
SeqKVTCSVRQSSAQNRKYTIKVEV
SSEEEEEEEEECCCCEEEEEEEEEE
3llpA374387EE5.70481970.741620150.710307315.194727
SeqGFIGCRTGTLDANR
SSEEEEEECCCEEEEEE
1pguA253268EE6.30743477.315197153.868993312.314939
SeqIFALSWLDSQKFATVG
SSEEEEEEECCCCEEEEEE
3lnnA293308EE5.40165673.239722144.341816312.573161
SeqTRAFVEVAPWQFEPRV
SSEEEEEEECCCCEEEEEE
2bwnA2438EE6.49827479.115622139.879835315.735623
SeqDIEREKGAFPKAQWN
SSEEEEECCCCCCEEEEE
2hzqA6485EE5.48548687.309628137.634891312.867880
SeqVNQIEGEATPVNLTEPAKLEVK
SSEEEEEEEEEEECCCCCCCEEEEE
4gqbB775792EE6.61537374.727662155.595154313.154417
SeqVTCVAASPHKDSVFLSCS
SSEEEEEEECCCCCCEEEEEE
4e0eA3352EE6.92179880.933388148.847983308.962384
SeqIAFRWKALPDTRGFILEVAV
SSEEEEEEEECCCCCEEEEEEEE
2v9lA90107EE6.22487281.438968143.832175310.571585
SeqLGIVKVDSDGAGYHILWG
SSEEEEEEECCCCCEEEEEEE
2pyxA279296EE7.01957877.445622155.787057310.838286
SeqGWIWDIGLPTRKGVGYVY
SSEEEEEEEECCCEEEEEEEE
4geyA368394EE5.56891881.361732157.377706309.096435
SeqTEYNAELYYGFHVTNWLTVRPNLQYIK
SSEEEEEEEEEEEEECCCCEEEEEEEEEEE
4fxiA5065EE6.72196371.030649156.688911310.003624
SeqKIKLRSSGYRLVYQVI
SSEEEECCCCCEEEEEEEE
1sp3A307333EE5.66654774.854779135.019376295.162377
SeqTYPMGDINDAKAKIYPFKVHTGKQIYD
SSEEEECCCCCCCCCEEEEEEEEEEEEEEE
4rg1A102121EE6.30307260.781515132.815634308.819559
SeqFREGIVVDRPTRPGHGSFVN
SSEEEEEEECCCCCCCCCCEEEE
3nokA113126EE6.23498183.783261146.138144315.475435
SeqKLVRSDGGTMLTFH
SSEEEEEECCCCEEEEE
1y791380400EE6.91531578.204332137.282865304.813097
SeqKFVERFDIPVYHPDVRVWEIF
SSEEEEEECCCCCCCCCCEEEEEE
4agiA7088EE5.44662466.458056152.275277313.035129
SeqHIRVYTLTEGNTLQEFAYD
SSEEEEEEEECCCCEEEEEEEE
3l7yA174188EE6.02670180.144718144.557321310.986781
SeqLVGTASGFGYIDIIT
SSEEEEEECCCCEEEEEE
5bv3A173195EE6.32638073.820159144.883299314.160406
SeqFLILPDMKWDGMNLDSLYLVAIV
SSEEEEEECCCCCCCCCCCCEEEEEE
3mesA2442EE6.55491775.831906144.301504307.105147
SeqIEVKQIFSGLTNQLFVVSI
SSEEEEEEECCCCCCEEEEEEE
1n35A303327EE5.94651583.390088144.789870307.524741
SeqGGYCPNLEWLEPRSDYKFMYMGVMP
SSEEEEEEEEEECCCCCCCEEEEEEEEE
3q1pA113150EE5.46205764.093123156.891225296.489457
SeqYEVDHFKLLAIFDKEKHQPSPSATHVYKIFIGCEIIGG
SSEEEEEEEEEEEEEECCCCCCCCCCCCEEEEEEEEEEEEE
3nuaA7284EE6.61497674.239086157.754738316.349656
SeqFVEKLNDRDQLCK
SSEEEEECCCCEEEEE
5f5eA7181EE6.62071274.341739148.427042316.327736
SeqMFRIDDSEVVD
SSEEEECCCCEEEE
3ge3C844876EE5.94693172.829118144.056911311.537418
SeqMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVF
SSEEEEEECCCCCCCCCCCCCCCCCCCCCCEEEEEE
4uuyA103118EE6.59994283.098831147.774936312.281671
SeqLSSLHWINETTFLMGI
SSEEEEEEECCCCEEEEEE
4pswB545562EE6.22821470.679651157.945961314.456381
SeqFNTLAFSHHSSNLLAAAG
SSEEEEEEECCCCCCEEEEEE
1kdgA364396EE6.28139467.810331155.479920297.707067
SeqTRYAQGTVRPGAASVNSSLPYNASQIFTITVYL
SSEEEEEEEEEEECCCCCCCCCCCCCCCEEEEEEEE
1ddgA1237EE6.31639561.290030144.940468282.487399
SeqLVASLSVNQKITGRNSEKDVRHIEID
SSEEEEEEEEEEECCCCCCCCEEEEEEEE
4ewcA126141EE5.51405368.145939145.332443303.925706
SeqKLNVVTANGKVKQVEV
SSEEEEEEECCCEEEEEEE
2xbgA288301EE6.90475677.614690147.043357312.820899
SeqQGFILGQKGILLRY
SSEEEEEECCCCEEEEE
4nlmA195212EE6.58495272.933704150.941605306.240900
SeqVLLTIEKNSDEKLLYDFR
SSEEEEEEEECCCCEEEEEEE
3v0aB23572371EE5.59312470.343208151.470868310.129917
SeqEKYIDISEDNRLQLI
SSEEEEEEECCCCEEEEE
2qn4A97103EE6.65498084.147773138.778608316.595332
SeqHVGRRVV
SSEEECCEEE
1vk3A5469EE6.60110483.320513141.476803315.079608
SeqVVNLDDYYSVAFKIES
SSEEEECCCCEEEEEEEEE
3tufB193211EE6.38055969.991402155.999126315.561115
SeqGYVVEVEHADGLSTVYQSL
SSEEEEEEEECCCCEEEEEEEE
4pvkA252269EE6.73565480.662291152.563829307.330970
SeqLMIRIIAQGPKATFEAMY
SSEEEEEEEECCCEEEEEEEE
2gf6A7497EE6.20399677.785170156.399841304.979031
SeqKLTVLLNPKILSNKTIKFEFKVLK
SSEEEEEEEEEEECCCCEEEEEEEEEE
3tfmA163182EE6.54620369.272564151.524813315.466965
SeqIDSVCASDSPDRPNSFVIIT
SSEEEEEEECCCCCCCCEEEEEE
3ei3A257274EE6.80161785.312432147.587774308.441030
SeqIVCHNRVDPNGSRYLLGD
SSEEEEEEECCCCCCEEEEEE
1jmxB792805EE6.48063380.227072156.513219314.616143
SeqLYLGGTFNDLAVFN
SSEEEEECCCCEEEEEE
5cpcA6378EE5.78752775.846901144.838909316.673342
SeqFTIKMDASQTQFLLMV
SSEEEEEECCCCCEEEEEE
4gqbB816833EE6.51526177.988240150.061874310.802623
SeqPTSLAWHPQQSEVFVFGD
SSEEEEEEECCCCCCEEEEEE
3tm4A3047EE6.81323178.029086151.364188314.396073
SeqFQIEEKPLGIEGRLLLEA
SSEEEEEECCCCCCCEEEEEE
1v05A5268EE6.64116180.816273149.271281314.717441
SeqEVYVKHMGNRVYNVTYT
SSEEEEEEECCCCEEEEEEE
3b6hA430466EE6.71722678.121696146.789763314.056662
SeqLDLELINADVEIPEFDLSRYGFGLMQPEHDVPVRYRI
SSEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEE
4ox3A165188EE6.63090788.805383136.907248312.964709
SeqFIIRYPKNKEDITKYEYEPWHLRY
SSEEEECCCCCCCCCCCCCCCCCEEEE
4rctA116144EE6.31293583.929400146.945807314.814757
SeqKINGLIGSANLTCFWDSTERTYETMLHLN
SSEEEEEEEECCCCCCCCCCCCCCCCEEEEEE
4ploB110127EE6.91401876.149039155.256113311.646218
SeqVGVQAVALTHEAVRVSWA
SSEEEEEEEECCCCEEEEEEE
5dssB3551EE6.73848579.775564150.291156307.325736
SeqLRLGKTRNLNCPVTVLQ
SSEEEECCCCCCCCCCEEEE
3qd7X109129EE6.44915183.430914149.788400313.472042
SeqVQAYCTALPHHGGSGACYVAL
SSEEEEEEECCCCCCCCCEEEEEE
3k50A305327EE6.97359486.176741144.729549283.918785
SeqVATKPFVHPTDRFILNLVVCNVY
SSEEEEEEEECCCCCEEEEEEEEEEE
4c91A96116EE5.35267278.177720145.169867304.617450
SeqYILQVIANPCEGIDEAVVIIG
SSEEEEEEEEEEECCEEEEEEEEE
3r1kA216237EE6.27904888.899148150.795684312.622256
SeqGYALYRVDRTDLKLARVSELRA
SSEEEEEEEECCCCCCEEEEEEEEE
4m52A112126EE6.05350479.759031147.212431314.348457
SeqGYGTFADANTLLVDL
SSEEEEEECCCCEEEEEE
3dadA5899EE6.14465774.653326142.085455308.397810
SeqSALQVSPSGYYLDTELSLEEQREMGFYEEISKGRKPTLILRT
SSEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEE
3loyA131159EE6.91862687.160087150.006353289.566905
SeqVRVVCDPWMNGTDSKEDRMLIQCYMYLAS
SSEEEEEEEEEECCCCCCCCCCEEEEEEEEEE
4i1kA97115EE5.78249084.334957151.792363315.879088
SeqVCVFELLRTRDFVLKVTAF
SSEEEEEEECCCCCCEEEEEEE
2pbiB605623EE6.99373380.567560150.176637308.219500
SeqVLCLDLAPSETGNTFVSGG
SSEEEEEEECCCCCCCEEEEEE
4hfqA120155EE6.32931280.341975155.373614302.775068
SeqFKAKVERLLAVFDTNRFQLQSKQYTKFVFGCKLLDG
SSEEEEEEEEEEEEEECCCCCCCCCCEEEEEEEEEEEEE
4atoA3452EE6.26749581.024938144.436759315.590848
SeqPYVGVLEKINGHDYFVPLT
SSEEEEECCCCCCCCCEEEEEE
4pfoA715724EE6.32609071.522928158.835200315.710852
SeqYKFGLTKVFF
SSEEEECCCEEEE
4r5oA195207EE5.96045967.290895151.124390316.406741
SeqYGLVTGDGIRRID
SSEEEEEECCEEEEEE
3gwiA7088EE6.52968778.142624149.754325306.986388
SeqRMSVVVAENTEHHQLVCKG
SSEEEEEEEECCCCEEEEEEEE
4m9pA244258EE6.71906879.972914148.910019314.381039
SeqALVKDNGNGTYSCSY
SSEEEEEECCCCEEEEEE
1jlyA97114EE6.41174687.798802132.024649307.450736
SeqFKPLYVEEGNMKKVRLLH
SSEEEEEECCCCCCCEEEEEE
4x7rA99113EE6.08803769.154978150.930526316.538493
SeqTIEIEESKGISRYFD
SSEEEEEECCCCEEEEEE
3iagC224256EE6.14303080.042836144.245050314.297058
SeqFYIHLLDDDESEGEEFTVRDGYIHYGQTVKLVC
SSEEEEEECCCCCCCCCCCCCCCCCCCCCCEEEEEE
4jglA4764EE6.70739867.596328142.296900298.226956
SeqNIYTYVDGDNIQCTPGHF
SSEEEEEECCCCCEEEEEEEE
3e57A104142EE6.06654164.595866157.774048303.805255
SeqVDVSLRELEFLGLINSSTTEVSRVHLGALFLGRGKFFSV
SSEEEEEEEEEEEEEEEECCCCCCCCCEEEEEEEEEEEEEEE
4kiaA91109EE6.64032471.429208150.982980308.902443
SeqLQSTKLTKANNKFLIISFW
SSEEEEEEEEECCCEEEEEEEE
1ewfA364381EE5.73668773.898186151.228158310.086920
SeqGSMEVSAESNRLVGELKL
SSEEEEEEEECCCEEEEEEEE
4gf3A7995EE5.92948774.890473143.074822316.703308
SeqRCALDKDDHWLLWSQLN
SSEEEEECCCCEEEEEEEEE
4rscA385411EE6.42722660.524767143.803839298.565992
SeqQAFEFPQINYQKYGGKPYTYAYGLGLN
SSEEEEEEEECCCCCCCCCCCCEEEEEEEE
5aoxB102128EE6.80957474.002533149.930579313.308727
SeqYITLKKYDGRTKPIFEPADNKCLLRAT
SSEEEEEEECCCCCCCCCCCCCCEEEEEEE
2w9hA131156EE6.52718487.141504154.644739308.091691
SeqWEVASSVEGKLDEKNTIPHTFLHLIR
SSEEEEEEEEECCCCCCCCCCEEEEEEEE
2hqsA311329EE5.91970685.562118146.000609313.842043
SeqQNQDADVSSDGKFMVMVSS
SSEEEEEEEECCCCCEEEEEEE
3zsjA85101EE6.46496675.004321158.919673314.788768
SeqPFKIQVLVEPDHFKVAV
SSEEEEEEEEECCCEEEEEE
1yoaA114141EE6.95078978.667201151.803962289.477786
SeqYWLEAEVRHLYPGGDHSLVVAEVVEAGV
SSEEEEEEEEEEEECCCCEEEEEEEEEEEEE
3ffvA131147EE5.79247782.739525145.991839313.504658
SeqTLFIATLEEELEVISVC
SSEEEEEEECCCCCEEEEEE
3qnkA453472EE5.76189974.850355144.542680281.868706
SeqTLHGVRFVSPTEFKVTKTDI
SSEEEEEEEECCCCEEEEEEEEE
2b4hA2948EE6.74213189.004612131.951384304.835890
SeqASSIVKSGGLGYKWSEISFK
SSEEEEEEECCCCCCEEEEEEEE
4l9oA193211EE6.38120376.773974152.744468314.939060
SeqVNAASWAPISNTRRFVSGG
SSEEEEEEECCCCCCCEEEEEE
2idbA159167EE6.21812884.090447133.324214312.197290
SeqQQLIGKNKL
SSEEEECCCCEE
1l0qA198216EE6.29650282.133964155.251790309.810302
SeqAPSGIAVNPEGTKAYVTNV
SSEEEEEEEECCCCCEEEEEEE
5i5mA274289EE6.87114877.743662149.057830313.092597
SeqYFVANGKLSPTVSVVE
SSEEEEEECCCCCEEEEEE
1vhxA219EE6.47669473.350849157.859586314.755354
SeqLRILGLDLGTKTLGVALS
SSEEEEEEEEECCCEEEEEEE
3aj6A247269EE6.73959766.846673150.817359294.061437
SeqDTNRVLDVYNSQIANGTHVIVDS
SSEEEEEEEEECCCCCCCCCEEEEEE
3rsbA112139EE6.67567674.091053158.164276303.100351
SeqALAVIPKEKYPNPSIDFNGLVPADINVV
SSEEEECCCCCCCCCCCCCCCCCCCCCEEEE
4pvaA161179EE5.59164171.695655158.210394313.408626
SeqLCHLFSSDDNGHLYRSQTT
SSEEEEEEEECCCCEEEEEEEE
2rffA3157EE7.02228374.753544142.741200300.870255
SeqLEEVYIFGSRARGDYLDTSDIDILFVF
SSEEEEEEEECCCCCCCCCCCCCEEEEEEE
4nsxA190206EE7.02341584.081128148.591573304.579507
SeqITTAEPAPVLDIIALGT
SSEEEEEEECCCCCEEEEEE
4zsxA2040EE6.09469883.637062153.683148308.707328
SeqIRLVRKSQGRFKEEFNFDLSL
SSEEEEEEEEECCCCCEEEEEEEE
4k00A7396EE6.14265678.940070158.369728308.210049
SeqRLLVNLTITQASAHRFCCDYEISQ
SSEEEEEEEEEEECCCCEEEEEEEEEE
3i3lA213232EE6.68807583.443742152.715161312.179265
SeqGWVWMIPIKDDLYSVGLVVD
SSEEEEEEEECCCCEEEEEEEEE
5egqA3450EE6.11114177.339080144.050785312.388544
SeqIESRPSRLNKDEYEFFT
SSEEEEEECCCCCCEEEEEE
2ojhA154170EE6.24246487.270766148.206136312.995049
SeqNDGPDYSPDGRWIYFNS
SSEEEEEEECCCCCEEEEEE
3zc9A90109EE5.08938364.720320149.182490316.740731
SeqVWRVDNYDPSRGKWFITTGG
SSEEEEECCCCCCCCCCEEEEEE
From residue 49 to 74 type EH
jmol
SSEEEEEEEEEEECCCCCCCCCHHHHHHH
Distance11.089426Delta81.429468
Theta171.614128Rho155.513608
Geometrically equivalent Smotifs
PDBChainStartEndTypeDDeltaThetaRho
3ha2A224EH11.50515178.029199174.178187145.294723jmol
SeqTLIIVAHPELARSNTQPFFKAAI
SSEEEEEECCCCCCCCCCHHHHHHHH
2fy7A5683EH11.26946376.404121172.006995133.343564jmol
SeqKVAIIIPFRNRQEHLKYWLYYLHPVLQR
SSEEEEEEEEECCCHHHHHHHHHHHHHHHHH
1qg8A324EH10.34884690.147407175.615949138.963221jmol
SeqVSVIMTSYNKSDYVAKSISSIL
SSEEEEEEEECCCCCCHHHHHHHHH
4yweA250276EH10.74935071.897824170.249271157.051081jmol
SeqSPQIVFADADLDAALPVLVSAIVQNGG
SSEEEEEECCCCCHHHHHHHHHHHHHHHHH
3a9sA298324EH11.06068275.309769171.492357165.396702jmol
SeqAIVAGFQGQRQWTDYFPNGDFMETILN
SSEEEEEEECCCCCCCCCCCCCHHHHHHHH
1wyuA152173EH10.45224768.654829169.929026131.237772jmol
SeqGVLVSQGVHPEYRAVLRAYLEA
SSEEEEEECCCCHHHHHHHHHHHHH
3u7qB765783EH10.35524679.531025170.321819182.705380jmol
SeqNTVLLQPWHLEKTKKFVEG
SSEEEEECCCCCCHHHHHHHHH
3vylA202231EH11.47916174.619135164.683770159.459150jmol
SeqIGYVHIGESHRGFLGTGNIDFAAIFDALTA
SSEEEEEEECCCCCCCCCCCCCCHHHHHHHHHH
1kvkA323346EH11.60296367.186959165.462679146.018041jmol
SeqCGITLLKPGLERAKVEAAKQALTG
SSEEEEEEECCCCCHHHHHHHHHHHHH
4akfA249270EH10.29666679.748849160.737106180.197090jmol
SeqELERYSEDTTPQQSIAQVVQWS
SSEEEEEEECCCCCCCCHHHHHHHH
3fkdA114139EH11.81668376.541431168.348929148.695210jmol
SeqFCWLCNPNNPDGRLLQRTEILRLLND
SSEEEEEECCCCCCCCCCCHHHHHHHHHH
1t6nA101119EH10.69037769.081702159.234548180.999719jmol
SeqVAVFFGGLSIKKDEEVLKK
SSEEEEECCCCCHHHHHHHHHH
3cs3A5775EH11.37499895.204142178.021059184.967484jmol
SeqGAIILDWTFPTKEIEKFAE
SSEEEEEECCCCCHHHHHHHHH
4f9zA344370EH11.24489277.795781173.678957150.384029jmol
SeqIHLLLIMNKASPEYEENMHRYQKAAKL
SSEEEEEEEECCCCCCHHHHHHHHHHHHHH
3n17A247278EH11.38804087.615909171.514398127.549328jmol
SeqVMIGLPAAPAAAPSGGYISPTEMKKALNYIIK
SSEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHH
3og9A148174EH11.12915173.171042174.689763170.307384jmol
SeqHVFLSYAPNDMIVPQKNFGDLKGDLED
SSEEEEEEECCCCCCCCHHHHHHHHHHHHH
3up9A195217EH11.24927093.208080172.584228182.369743jmol
SeqVNVLVWKGDSKKVDAIAKLEKLL
SSEEEEEEEECCCCCHHHHHHHHHHH
1n2zA6079EH10.92702176.870133159.760365181.527003jmol
SeqLVIAWRGGNAERQVDQLASL
SSEEEEECCCCCCHHHHHHHHHH
3cneA326EH10.47383776.957705165.040097166.858590jmol
SeqKVAVLAVNPVNGCGLFQYLEAFFE
SSEEEEEEECCCCCHHHHHHHHHHHHH
1xfcA118150EH11.25188393.341090176.538800165.571780jmol
SeqATVTVKVDTGLNRNGVGPAQFPAMLTALRQAMA
SSEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHH
4hlnA313337EH10.91004679.409389160.103233144.793504jmol
SeqLIGFIGRLDYQKGIDLIKMAIPDLM
SSEEEEEECCCCCCCCHHHHHHHHHHHH
4dnxA223254EH11.28881190.341842171.745603154.073795jmol
SeqGVVIHMLLGQLKPGDIPAPVRDAAIRTMAELY
SSEEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHH
2j6lA271297EH10.14199169.283625167.332666154.744471jmol
SeqNAIIAFEDADLSLVVPSALFAAVGTAG
SSEEEEEECCCCCHHHHHHHHHHHHHHHHH
2r60A258279EH10.51965572.985911166.432120129.911930jmol
SeqAIIASSRLDQKKNHYGLVEAYV
SSEEEEECCCCCCCCCHHHHHHHHH
3kalA208234EH10.60787384.162498173.738938146.626985jmol
SeqAILVVVQVEERNMYEQHYISALLREKH
SSEEEEEEECCCCCCHHHHHHHHHHHHHHH
3tovA213229EH10.89365670.903928159.193143139.093694jmol
SeqKTVFFGGPDLEVQPVVE
SSEEEEECCCCCCCCHHHHH
3hurA121151EH11.00644374.890987172.038618161.737075jmol
SeqLKVSLAIDTGMTRIGFDKADEISAAKKIIDK
SSEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHH
3obeA215240EH11.24256681.865836167.677338186.473457jmol
SeqLLHIKDRWIIGDSGNFPNIFKKAYEI
SSEEEEECCCCCCCCCCCHHHHHHHHHHH
4zi5A160187EH10.27773084.334577158.182872159.050028jmol
SeqSVLVCHGADDPLVQDETMKAVMDEFRRD
SSEEEEEEEECCCCCCCHHHHHHHHHHHHHH
4xslA207236EH11.87584976.906492169.339603168.016776jmol
SeqMGHFHLGEANRLPPGEGRLPWDEIFGALKE
SSEEEEEEECCCCCCCCCCCCCCHHHHHHHHHH
2bogX4064EH10.54653970.188676168.599356128.939027jmol
SeqTWFAHHNPGQITGQVDALMSAAQAA
SSEEEECCCCCCCHHHHHHHHHHHHHHH
2qw5A234264EH10.70627478.991592160.056830185.303032jmol
SeqLHYVQVSPPDRGALHTSWLPWKSFLTPIVKV
SSEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHH
4uzsA260278EH10.14726078.375458175.531605144.991232jmol
SeqNFMVSAGGSMLDYDDWGAE
SSEEECCCCCCCCCCHHHHHHH
1o12A145162EH10.15615867.422564159.361951158.931763jmol
SeqTFAPEIESSELLLRLVKR
SSEEECCCCCCHHHHHHHHHH
4prkA148167EH10.51738870.773419176.771545170.036525jmol
SeqTIGLIGVGHIGSAVAQIFSA
SSEEEEEECCHHHHHHHHHHHHH
4fqdA111127EH12.05433270.908833167.157482125.679897jmol
SeqVARLSARPDEHLLDVMG
SSEEEEECCCCCHHHHHHHH
2ftxB123144EH11.40973466.498682172.473008182.697848jmol
SeqDILPLDNNLSDFYKTKYIWERL
SSEEEEECCCCCCHHHHHHHHHHHH
4e3xA300326EH10.65264775.210985170.332978172.550672jmol
SeqNFHFVHSSADVDSVVSGTLRSAFEYGG
SSEEEEEECCCCCHHHHHHHHHHHHHHHHH
3wwnA226EH11.18705473.961896173.797709127.732589jmol
SeqIVVKVGGAEGINYEAVAKDAASLWK
SSEEEEEECCCCCCCHHHHHHHHHHHHH
2yxbA105127EH10.35811172.657342166.458952178.814961jmol
SeqEIFLPGTSLGEIIEKVRKLAEEK
SSEEEECCCCCHHHHHHHHHHHHHHH
1zgzA94116EH10.45714786.065085167.107699162.069248jmol
SeqDYVTKPLELRELVVRVKNLLWRI
SSEEEEECCCCHHHHHHHHHHHHHHH
3fceA7896EH10.33039675.471989166.056497144.845696jmol
SeqYIPVDLSIPADRVQRIAEN
SSEEEEEECCCCHHHHHHHHHH
1vluA226244EH11.11719567.505708165.225010181.483503jmol
SeqSIYLDEDADLIKAKRISLD
SSEEEEECCCCCHHHHHHHHHH
4x7rA351370EH11.59766374.564013163.038074126.770752jmol
SeqKFHIYGEGSVKDKIAKMIED
SSEEEEEECCCCCHHHHHHHHHH
4g4gA270300EH10.47144667.792818165.752515166.693071jmol
SeqGLAVFENNIDWLGPVSTTGCMAAGRLIYKAY
SSEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHH
3bcvA526EH10.58077195.812495171.632238165.976260jmol
SeqVSVIVPIYNVEKYLDQCVQALL
SSEEEEEEEECCCCCCHHHHHHHHH
5afdA162184EH11.04678266.954888163.138679173.789728jmol
SeqLSGLKFNSGDLYEYQRCLRACDG
SSEEEEEEECCCCHHHHHHHHHHHHH
1pzxA420EH11.05787689.447703171.328458175.593904jmol
SeqEIITDSGADLPQSYIRE
SSEEEEEECCCCCCHHHHHH
4yn8A7592EH10.17485291.532107167.814651149.861113jmol
SeqVLILTTYDTEADILAAVE
SSEEEEEECCCCCCCHHHHHH
2f9fA1536EH11.13448889.041282168.862741139.467747jmol
SeqWLSVNRIYPEKRIELQLEVFKK
SSEEEEECCCCCCCCHHHHHHHHHH
1eokA175194EH10.36112184.265250162.281747132.588275jmol
SeqQLQIASGIDVYAWNKIMENF
SSEEEEEEECCCCCCHHHHHHHH
2zvrA197226EH11.52758880.268327165.089648161.110159jmol
SeqLYHFHVADSNRWAPGCGHFDFRSVFNTLKE
SSEEEEEEECCCCCCCCCCCCCCHHHHHHHHHH
3hbmA183202EH10.79286385.244592165.922300155.721049jmol
SeqISIATSSSNPNLKKLQKFAK
SSEEEEEECCCCCCHHHHHHHHH
4n6oA4193EH11.13200276.067315174.135564158.245130jmol
SeqIVVMMYDDIAYSEDNPTPGIVINRPNGTDVYQGVPKDYTGEDVTPQNFLAVLR
SSEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
3c70A198220EH11.03956970.353363167.478081170.174118jmol
SeqKIYVWTDQDEIFLPEFQLWQIEN
SSEEEEEECCCCCCCCHHHHHHHHHH
3wqoA201235EH11.67354680.730559173.398405164.068593jmol
SeqIIHVHAHDNNGYDDEHLKIGEGNINFIEVLEKLKE
SSEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHH
3nvsA306325EH11.21163388.648817171.195642134.913358jmol
SeqDLDFNHIPDAAMTIATTALF
SSEEEECCCCCCCHHHHHHHHHH
1o98A253272EH11.62038574.352315173.779393185.731418jmol
SeqAIIFYNFRPDRAIQISNTFT
SSEEEEECCCCCCCCHHHHHHHH
4ogdA234259EH11.05436468.396133168.008543150.752146jmol
SeqAFIILDDADWDQLEKVLYFSRLYNAG
SSEEEEECCCCCHHHHHHHHHHHHHHHHH
4pqgA356375EH11.85876280.400519165.072132135.146537jmol
SeqTFDIYGSGGEDSLLREIIAN
SSEEEEEECCCCCHHHHHHHHHH
2nlzA472489EH11.13375371.482207172.319713130.862302jmol
SeqQVQVEPTFPVDIAQALVR
SSEEEEECCCCCHHHHHHHHH
3rh9A251276EH10.36903667.936630167.782569150.169642jmol
SeqPFIVFDDADLEAAADNLIANKFRGGG
SSEEEEECCCCCHHHHHHHHHHHHHHHHH
4jbeA230249EH11.28955369.231720167.073366179.849686jmol
SeqGVLYVDEKADRDTVRSLVVN
SSEEEEEECCCCCHHHHHHHHHH
2a1vA88117EH11.27955276.053114156.910343181.683460jmol
SeqWVTVTLDGTVPAELLGELLRGSYLLVTKKG
SSEEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
4ac1X151182EH11.93067868.272402176.497428137.092978jmol
SeqLITLAPVASALEDSSNLSGFSYTALQQTQGND
SSEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHH
4b91A149176EH11.32326472.807004169.026232184.113986jmol
SeqSFQMFMTYKDLYMLRDSELYQVLHACKD
SSEEEEEECCCCCCCCCCHHHHHHHHHHHHH
2nwhA135156EH11.05851367.941427169.464832171.366594jmol
SeqFLLCDANLPEDTLTALGLIARA
SSEEEEEECCCCHHHHHHHHHHHHH
4gdxB475491EH10.76214073.003744171.955093144.854598jmol
SeqTTVERNIDQAVTAALET
SSEEEECCCCCHHHHHHHHH
3vwaA152173EH11.31850884.712648157.776263174.763310jmol
SeqSSKEGLSAFEFASRARSYYNII
SSEEECCCCCHHHHHHHHHHHHHHH
1o20A224246EH11.34819866.807006173.054525183.683744jmol
SeqCHIFVDESADLKKAVPVIINAKT
SSEEEEEECCCCCHHHHHHHHHHHHH
3ha9A3864EH10.20987486.325919163.984472159.758557jmol
SeqVVILWFMAAWCPSCVYMADLLDRLTEK
SSEEEEEEEECCCCCCHHHHHHHHHHHHHH
3md9A6179EH10.25710981.419851160.235322167.433642jmol
SeqMLLVSELAQPSLVLTQIAS
SSEEEEEECCCCCHHHHHHHHH
1euhA254280EH10.37700672.087326169.513679151.143317jmol
SeqDSAIVLEDADLELTAKNIIAGAFGYSG
SSEEEEEECCCCCHHHHHHHHHHHHHHHHH
3u0hA195235EH10.31720175.481558170.349887162.194934jmol
SeqVVYVHINDTRDAPEDAHDGKRLLPGDGRIPLVPFLRGLYLA
SSEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
4zemA160180EH10.27960773.502194158.891313142.360718
SeqYVLAYQPSKTVERFLVKAASK
SSEEEEEECCCHHHHHHHHHHHHH
2zayA100122EH10.53032382.115351179.283058158.566194
SeqDFIAKPVNAIRLSARIKRVLKLL
SSEEEEECCCCHHHHHHHHHHHHHHH
4ifdE13011313EH11.22280078.772742158.666523166.214328
SeqNMLLDPAANESEV
SSEEEEECCCHHHHHH
2pjzA246260EH11.75557682.104182176.157862135.061253
SeqMKFGALGSLNRIYGI
SSEEECCCCCCCCHHHHH
4zdpA145162EH11.10767480.348513173.707262178.570398
SeqYIIWPRIDQKSCFKSMIT
SSEEEEEECCCCHHHHHHHHH
3cxgA1227EH10.22059283.011630161.132594139.818051
SeqSIYIELKNTGSLNQVF
SSEEEEEECCCCCHHHHHH
4yshA324EH10.76035471.733775170.941714161.616178
SeqRYDVAIVGGGVIGAAIGFELAK
SSEEEEEEEECCCHHHHHHHHHHHH
5ar1A78101EH10.82878584.491247166.485053166.701313
SeqCCLYLINPTGHGLKEIDVEFIRQL
SSEEEEEEECCCCCCCCHHHHHHHHHH
3hxsA3257EH10.34712085.123324157.731241177.219643
SeqAIVDFYADWCGPCKMVAPILEELSKE
SSEEEEEEECCCCCCHHHHHHHHHHHHHH
3lk7A3151EH10.62095192.675363157.887107184.855064
SeqIVTVNDGKPFDENPTAQSLLE
SSEEEEEEECCCCCCCHHHHHHHH
2g76A321EH11.08663775.107199177.985602162.419066
SeqKVLISDSLDPCCRKILQDG
SSEEEEECCCCCHHHHHHHHHH
1rlzA7396EH11.51692175.703480161.207842182.757099
SeqTIFLGYTSNLISSGIRETIRYLVQ
SSEEEEEEECCCCCCCCHHHHHHHHHH
1u0tA226EH10.48053885.356099176.698707172.223952
SeqSVLLVVHTGRDEATETARRVEKVLG
SSEEEEEEECCCCCCCCHHHHHHHHHHH
1toaA181208EH10.44379074.419609168.473411169.555744
SeqEVKGLQGVSTASEASAHDMQELAAFIAQ
SSEEEEEEECCCCCCCCCHHHHHHHHHHHHH
3gg2A319348EH10.83994278.256956168.352967170.005390
SeqCVAIWGLSFKPGTDDMREAPSLVLIEKLLE
SSEEEEEECCCCCCCCCCCCCCHHHHHHHHHHH
7fd1A219EH11.78907788.279794161.450971126.921203
SeqFVVTDNCIKCKYTDCVEV
SSEEEECCCCCCCCCCHHHHH
3e1tA223EH10.94955571.844746170.880906150.029984
SeqEVFDLIVIGGGPGGSTLASFVA
SSEEEEEEEEECCCHHHHHHHHHHH
4zm6A433457EH10.22566070.801806161.954167183.778620
SeqWVIIGTANANLYPFQVRMVQQAQKL
SSEEEEEEECCCCCCHHHHHHHHHHHHH
3o0hA424EH10.11390966.578681164.068491178.894716
SeqFDLFVIGSGSGGVRAARLAGA
SSEEEEEEECCCHHHHHHHHHHHH
5ix8A1743EH10.30366067.752557172.768153126.670794
SeqKLGVTVVHLLDNFYKGIAYGIVDEARR
SSEEEEEEECCCCCHHHHHHHHHHHHHHHH
4o32A333EH10.30841770.218251163.985223182.047968
SeqVIVLYFFAKWCQACTMQSTEMDKLQKYYGKR
SSEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHH
5djsA408426EH10.30060172.185799164.274747171.388609
SeqVALDTLPYSGCTTSLEALW
SSEEEECCCCCCCCHHHHHHHH
4v1tA142164EH10.30009478.772365166.427106126.337260
SeqNVVLTDDYLQPELAKINKQALES
SSEEEEECCCCCCCHHHHHHHHHHHH
2yhgA426EH10.46064770.243601159.074750158.248862
SeqRVIHTTDMGADPDDEQSLVRQLV
SSEEEEEEECCCCCCHHHHHHHHHHH
4zhwA532EH11.34488879.000981156.912421176.423685
SeqKVLFGNNLDRLNPDSRNTLTKIARALLA
SSEEEECCCCCCCCCHHHHHHHHHHHHHHHH
5fhiA225EH10.32241284.798068161.617697152.356082
SeqVFGTLYTFPGDQCRTIAIKAVAKA
SSEEEEEEECCCCCCCCCHHHHHHHHH
2d5wA740EH10.67045668.460606162.889087125.004800
SeqSLVIGASQEPRVLAGDFLRVISNQAIKSEIEQYL
SSEEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHH
2b4aA94112EH10.10834873.922706166.559143148.939152
SeqLSYLQKPFAISELRAAIDY
SSEEEEEECCCCHHHHHHHHHH
2bjiA208228EH11.20726292.496977163.908316160.518769
SeqAYYEMGIHCWDVAGAGIIVTE
SSEEEEEECCCHHHHHHHHHHHHH
3mpkA198220EH11.08944187.734232167.067673157.593742
SeqAEIALATTRGQTELMSILNKALY
SSEEEEEEEEECCCHHHHHHHHHHHH
2o3aA3152EH11.36653184.019460171.691299131.460149
SeqGIYFDTEDKSVFESVRDVVERW
SSEEEEECCCCHHHHHHHHHHHHHH
1mv8A315344EH10.76928373.116448166.218356170.129325
SeqKVGLLGLSFKAGTDDLRESPLVELAEMLIG
SSEEEEEECCCCCCCCCCCCCCHHHHHHHHHHH
4makA221EH10.55569390.684209165.387820176.631114
SeqMLVVVTENVPPRLRGRLAIW
SSEEEEEEEECCCHHHHHHHHHH
4relA337354EH10.22987774.624476168.402420162.587932
SeqVGVFVTHCGANSVMESVS
SSEEEEEEECCCHHHHHHHHH
2qxyA98117EH11.40837777.805043169.437959184.532016
SeqYILKPFRLDYLLERVKKIIS
SSEEEECCCCHHHHHHHHHHHHH
4z0vA316336EH11.82750481.754733162.921266127.887263
SeqVIFCGDFNSTPSTGMYHFVIN
SSEEEEEEECCCCCCCHHHHHHHH
5ji5A156173EH11.10498790.282492170.460757160.214881
SeqVAIIDFDVHHGNGTEAAF
SSEEEEEECCCCCCHHHHHHH
5e3jA98118EH11.23026778.415997176.103020174.303969
SeqDYVAKPVQPRVLLARIRALLR
SSEEEEECCCCHHHHHHHHHHHHH
3r24A122158EH10.95331268.491872175.448792165.217028
SeqWDLIISDMYDPRTKHVTKENDSKEGFFTYLCGFIKQK
SSEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
3thxA175197EH11.44427167.789570163.392891185.148486
SeqECVLPGGETAGDMGKLRQIIQRG
SSEEEEEECCCCCHHHHHHHHHHHHH
2p9bA89110EH10.84434578.056496157.579785152.573866
SeqVTTIRTLGDVGYEVVTLRDQID
SSEEEEEEECCCCCCHHHHHHHHHH
3pc3A452466EH10.53165986.504586165.948494174.070471
SeqRLNESEILGKLARVL
SSEEEECCCCHHHHHHHH
4ry9A5981EH10.44402690.515848175.131745145.827172
SeqVKLLIINPADSEGLVNAVNNASA
SSEEEEEEEECCCCCCCHHHHHHHHH
3r7fA149171EH10.09995578.407300158.325200182.872421
SeqTVSIHGDIKHSRVARSNAEVLTR
SSEEEEEECCCCCCHHHHHHHHHHHH
2pzeA182195EH10.83954068.218055168.855710130.896934
SeqTRILVTSKMEHLKK
SSEEEEEECCCHHHHHH
1g8pA89102EH11.65316468.017229159.890017184.129307
SeqVVDLPLGVSEDRVV
SSEEEEECCCCCHHHHH
3s8mA5789EH11.22013074.246098168.687763183.619880
SeqDTLGVFFEKPGTASKAGTAGWYNSAAFDKHAKA
SSEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH
4j0dA411437EH10.32077270.580035161.961757182.702047
SeqHWRIRHGAADRDTSFAIPIILAIMLEN
SSEEEEEECCCCCCCCCCHHHHHHHHHHHH
1zymA225237EH11.30702070.998876157.179590164.715373
SeqVYVNPTNEVIDKM
SSEEEECCCHHHHHHH
4kl0A2248EH10.31208377.546567170.639603143.040718
SeqLDTLLFTDPNKDPDDVVTYTIAKQLQA
SSEEEEEEEECCCCCCHHHHHHHHHHHHHH
2vqmA174191EH10.79493887.248637169.459066166.068159
SeqILIVDWDVHHGNGTQQAF
SSEEEEEECCCCCCHHHHHHH
4m52A225EH11.75483074.154401165.686914156.639830
SeqMTHYDVVVLGAGPGGYVAAIRAAQ
SSEEEEEEEEEECCCHHHHHHHHHHHH
3ozpA421439EH10.86483778.192027158.958107173.617565
SeqYIIQVWTTGVDPQIKGLLE
SSEEEEEECCCCCCHHHHHHHH
2wolA2756EH11.84486479.674746159.511229157.468302
SeqTLRLVSSADVDSLDPARTYYVWVWLLQRLL
SSEEEEEEECCCCCCCCCCCCCCHHHHHHHHHH
3uf6A1535EH11.65481777.683577168.328139156.469260
SeqVFAVAGADDEVVLETIRLALK
SSEEEEEECCCCHHHHHHHHHHHH
2dc0A69106EH10.97150693.584971167.782535173.555423
SeqPLTVKDLFPVKGMPTRAGTKAPLPPLPEEARAVRRLRE
SSEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH
1yq2A476490EH11.17238078.705031176.092888131.487138
SeqYSRMYSSIPETDSIG
SSEEEEECCCHHHHHHHH
4ru8A136154EH10.77762068.996434162.378795145.462626
SeqYILIDTAPSDVVTIKPILR
SSEEEEEECCCCCCCCHHHHHH
3gt7A100121EH10.41434084.523320172.134337174.361696
SeqDFITKPCKDVVLASHVKRLLSG
SSEEEEECCCCHHHHHHHHHHHHHH
3cnbA101121EH10.75588190.779980163.054597168.279806
SeqTCFGKPLNFTLLEKTIKQLVE
SSEEEEECCCCHHHHHHHHHHHHH
4bjhB570592EH10.61784980.294822167.812910168.169609
SeqRVLYVGDIKHSRVFRSGAPLLNM
SSEEEEEECCCCCCHHHHHHHHHHHH
2z67A152169EH11.31555179.090315170.518550174.780447
SeqVVIYPYASHKSPIKAVSF
SSEEEEEECCCCHHHHHHHHH
4y5tA824EH10.97606888.907598158.903267161.312053
SeqRLAADADVDRMCRLLEE
SSEEEECCCCHHHHHHHHHH
1orrA2646EH10.88465479.743090165.293679162.198183
SeqDLIVFDNLSRKGATDNLHWLS
SSEEEEEEECCCCCCHHHHHHHHH
3ffhA176199EH11.87814693.787170175.263050144.525173
SeqLVVLDEAYIEYVTPQPEKHEKLVR
SSEEEEEECCCCCCCCCCCCCCHHHHH
4egwA2948EH10.26813971.722732160.494056149.814012
SeqIWIDCYDPKDEELYKLSKKI
SSEEEEEEECCCHHHHHHHHHHH
2pw6A325EH10.49075567.069310159.461266159.063005
SeqALFLGHGPNVLEDNLYTRSWQKL
SSEEEEEECCCCCCCCCHHHHHHHHH
2pz0A181199EH12.00425295.421311174.892240160.708852
SeqSLHPFYFNIIPELVEGCKK
SSEEEEEECCCCCHHHHHHHHH
1vljA3661EH11.26055385.575172174.751371131.198760
SeqKVLFLYGGGSIKKNGVYDQVVDSLKK
SSEEEEEEECCCCCCCCCHHHHHHHHHHH
1y44A5478EH11.61219695.120431173.694685134.581541
SeqIEKIFITHHGDHVYGLPGLLGSRSF
SSEEEEEECCCCCCCCCCHHHHHHHHHH
3h5tA112130EH10.99704889.616939169.011574156.826504
SeqVVIYSVAKGDPHIDAIRAR
SSEEEEECCCCCCHHHHHHHHH
4z54A118141EH10.55908978.847183169.014714170.448487
SeqCCLYFISPTGHSLRPLDLEFMKHL
SSEEEEEEECCCCCCCCHHHHHHHHHH
3kpbA1430EH10.43878876.389260176.380255163.128537
SeqAHSNISIMEAAKILIKH
SSEEECCCCHHHHHHHHHHH
2obxA68101EH11.65022568.946019169.262399179.774874
SeqAVLGTAFVVNGGIYRHEFVASAVIDGMMNVQLST
SSEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHH
4m83A227EH11.94033367.216558170.639530182.916335
SeqHIAMFSIAAHGHVNPSLEVIRELVAR
SSEEEEEECCCCCCCCHHHHHHHHHHHHH
2r8rA81109EH11.02943468.942932170.389519178.546636
SeqLVLVDELAHTNAPGSRHTKRWQDIQELLA
SSEEEEECCCCCCCCCCCCCCCHHHHHHHHHH
4peiA138148EH10.64015467.821326159.204603149.942078
SeqYTYPPSPNDVV
SSEEECCCCHHHHH
3hm7A146177EH10.52406678.405656168.325804174.709015
SeqGFKAFMSECGTDDFQFSHDETLLKGMKKIAAL
SSEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHH
3dkpA210229EH10.79984588.541296170.079709170.261747
SeqRRAMFSATFAYDVEQWCKLN
SSEEEEEEECCCCHHHHHHHHHH
3mwdA301323EH11.86475275.750677176.454715176.143725
SeqNYGEYSGAPSEQQTYDYAKTILS
SSEEEEEEECCCCHHHHHHHHHHHHH
3n53A88115EH10.66330086.371547170.847717160.125821
SeqDYLTKPFNRNDLLSRIEIHLRTQNYYSD
SSEEEEECCCCHHHHHHHHHHHHHHHHHHHH
4l22A486515EH11.27265593.178526157.920030155.894064
SeqIIDTQIKRFHEYKRQQMNALYVIYKYLEIK
SSEEEEEEECCCCCCCCHHHHHHHHHHHHHHHH
4z24A225EH11.45306566.789240159.420377164.902804
SeqLTGDIVIIGAGAAGSLLAHYLARF
SSEEEEEEEEECCCHHHHHHHHHHHHH
3ni2A7293EH10.51021678.440361172.641414171.156877
SeqVIMLFLPSSPEFVLAFLGASHR
SSEEEEEECCCCHHHHHHHHHHHHH
2x3lA95112EH11.17460780.686157163.084964176.200808
SeqILMARNVHKSVLHALDIS
SSEEEECCCCCHHHHHHHHHH
1x7oA205223EH11.51416974.096728161.998581184.540179
SeqTLLLIGNETAGLSNAWRTL
SSEEEEEECCCCCCCCHHHHHH
4ei7A4760EH10.47053672.227563169.623351125.023976
SeqRAILVNTNSQDFNK
SSEEEEEEECCCHHHHH
2wnwA264284EH10.57501787.876592167.116895126.566575
SeqGLAFHWYTGDHFSQIQYLAQC
SSEEEEEECCCCCCHHHHHHHHHH
3q2iA1232EH10.15270089.292188167.261060147.007625
SeqIRFALVGCGRIANNHFGALEK
SSEEEEEEECCCCCHHHHHHHHHH
1sfsA2853EH10.51331181.791216171.121683127.393388
SeqFWGRYLSEVPNVSEGLTRDEIVRIRN
SSEEEEEECCCCCCCCCCCCHHHHHHHHH
1nrjB221254EH11.53481594.188294176.159509171.600413
SeqVKGLIFMVDSTVDPKKLTTTAEFLVDILSITESS
SSEEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHH
3kkeA212224EH11.20009387.183207158.694523142.275650
SeqSIVGINTTWVSDT
SSEEEEEECCCHHHHH
3eqzA99120EH10.89296895.154344168.436684139.053326
SeqNVINTFTKPINTEVLTCFLTSL
SSEEEEEEEECCCCHHHHHHHHHHH
4ojxA115139EH11.13978788.120193160.498170179.855451
SeqITDYYITHPHLDHISGLVVNSPSIY
SSEEEEEECCCCCCCCCHHHHHHHHHHH
4uxdA199217EH10.41696190.385498174.984890159.657423
SeqGGVCGTTNFSDGIVRLYHE
SSEEEECCCCCCCCHHHHHHHH
3hm2A92109EH10.48227188.063468167.304623177.547471
SeqVIFIGGLTAPGVFAAAWK
SSEEEEECCCCCCCHHHHHHH
3mprA169188EH11.73781381.693180173.041518162.275107
SeqAILTGDFNVDQTHQSYDAFV
SSEEEEEEECCCCCCCHHHHHHH
1wf3A87112EH10.44334893.265265163.738099181.321071
SeqAVVWVVDLRHPPTPEDELVARALKPL
SSEEEEEEEECCCCCCHHHHHHHHHHHHH
3a11A126145EH11.16511870.531749165.408214159.667115
SeqVIMTHCHSKAAISVMKTAWE
SSEEEEECCCCHHHHHHHHHHHH
3gg9A161180EH10.35423666.886247171.802486182.549116
SeqTLGIFGYGKIGQLVAGYGRA
SSEEEEEECCCHHHHHHHHHHHH
5e5bA285314EH11.03553084.593822163.473682155.204328
SeqLVRTLMVDPSQEVQENYNFLLQLQEELLKE
SSEEEEEEEECCCHHHHHHHHHHHHHHHHHHHH
3cl6A250278EH11.91766771.836924161.944412169.332818
SeqKMLSIGLHCRLIGRPARLAALQRFIEYAK
SSEEEEEEEEECCCCCCHHHHHHHHHHHHHHH
4pmoA3262EH10.19016784.394453166.729924136.348166
SeqGAIRYVSDRRPGGAWMLGKPIQLSEARDLSG
SSEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHH
3f4sA173197EH11.84671181.899038169.015737146.474722
SeqKHGGYKELKYFTNVIDKLYGKAIVK
SSEEEECCCCHHHHHHHHHHHHHHHHHH
4rk6A229EH10.24284793.517926175.823995152.378404
SeqVVGVVVPLIHTNFADEIIKGLYETTISS
SSEEEEEEEECCCCCHHHHHHHHHHHHHHHH
1i36A221EH10.48286076.991828168.521327178.596179
SeqRVGFIGFGEVAQTLASRLRS
SSEEEEEECCCHHHHHHHHHHHH
5bvaA223EH10.71005773.108671168.945847162.303497
SeqHYDVVIIGSGPAGSLCGIECRK
SSEEEEEEEECCCHHHHHHHHHHHH
3wv4A5877EH11.14772171.531627171.246207182.697141
SeqRIVVQLPNIRQTVAVFYGAC
SSEEEEEECCCCHHHHHHHHHHH
2ehpA936EH11.93283991.829013172.240368149.882420
SeqVEGVPGNYPLTAENLFRIGLALCTLWIL
SSEEEECCCCCCCCHHHHHHHHHHHHHHHHH
3pdkA278295EH10.20041888.899648158.493958158.598261
SeqTVVSTVMSNLGFYKALEA
SSEEEEEECCCCHHHHHHHHH
4pzvA171199EH10.19087976.367369174.956900184.046481
SeqIRMGIVNLSSDGNFDDNQRKLNLDELIQS
SSEEEEEEEECCCCCCCCCCHHHHHHHHHHHH
3jx9A77100EH10.93925188.963025164.503564176.381606
SeqRVLIFTPDTERSDLLASLARYDAW
SSEEEEEEECCCCCHHHHHHHHHHHHH
4jxjA2339EH10.09068487.586406173.750001181.482854
SeqNVLEIGPGTGGLTRSIL
SSEEEEEECCCCCHHHHHHH
4ry8A214229EH11.38887077.402222166.476895165.458976
SeqKVYSVDVTTEDIQMMI
SSEEEEEECCCHHHHHHHH
2h5gA245262EH11.66877280.839634162.731514171.360825
SeqTLLIHRDLLRTPLFDQII
SSEEEEEECCCCCCHHHHHHH
3r44A5980EH10.60935180.303217168.380360179.623883
SeqRVALLMPNSVEFCCLFYGAAKL
SSEEEEEECCCCHHHHHHHHHHHHH
1ml4A155178EH10.57519572.693110160.901998169.427717
SeqLKIGLLGDLKYGRTVHSLAEALTF
SSEEEEEEECCCCCCHHHHHHHHHHHH
3js8A435464EH11.43525688.161264172.829939127.519147
SeqVAVWLDILTLPGTPYANQFYREIEQWIEAN
SSEEEEEEEEEECCCCCCHHHHHHHHHHHHHHH
2nxwA100123EH10.92444695.078434166.089948175.994119
SeqVVVISGAPGTTEGGLLLDTQFQVF
SSEEEEEEEECCCCCCCCCCCHHHHHH
1kwgA347388EH11.35968678.200126174.926706155.100716
SeqVSYFRWRQAPFAQEQMHAGLHRPDSAPDQGFFEAKRVAEELA
SSEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
3a1fA5483EH11.50415695.384171160.673877167.483739
SeqKIYFYWLCRDTHAFEWFADLLQLLESQMQE
SSEEEEEEEEECCCCCCHHHHHHHHHHHHHHHH
3cfyA99125EH10.39980080.071126171.323220169.153462
SeqDFLEKPINADRLKTSVALHLKRAKLED
SSEEEEECCCCHHHHHHHHHHHHHHHHHHH
4iilA140154EH11.69253477.339296166.159817139.769644
SeqKIGLIAGQSYPVMTQ
SSEEEEEEECCCCHHHHH
1peaA163189EH10.22468666.608130177.566488144.437645
SeqTVLEEIYIPLYPSDDDLQRAVERIYQA
SSEEEEEEEEECCCCCHHHHHHHHHHHHHH
1dbqA122141EH11.47558771.195919170.715985147.314775
SeqIGVIPGPAGRLAGFMKAMEE
SSEEEEECCCCHHHHHHHHHHHH
4x3lA203221EH10.88279373.612404168.670949158.048711
SeqVAFLLGAEDKGLPEAWKRR
SSEEEEEECCCCCCCCHHHHHH
4z38A7294EH10.37444870.533184161.288495175.334020
SeqGMNLRFEPDHQDREKELIDLYIK
SSEEEEEECCCCCCHHHHHHHHHHHH
3g79A352382EH10.39993784.851902174.773173148.807106
SeqKVAMLGWAFIKDSDDARNTPSEPYRDLCLKA
SSEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHH
2zy4A492522EH11.01172668.858866162.640278134.561338
SeqSGRASLANLNEYEYAAIGRALRKMADELYAE
SSEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHH
3d22A100122EH11.36884582.587103175.021322176.144643
SeqQQVDKLVGANKPELHKKITAILD
SSEEEEEEEECCCHHHHHHHHHHHHH
3c5cA138163EH10.49658167.661953164.835254158.852949
SeqLFFEVSACLDFEHVQHVFHEAVREAR
SSEEEEECCCCCCCHHHHHHHHHHHHHHH
4pqgA533EH10.99221173.381136167.710931174.815023
SeqTIYNINLGIGWASSGVEYAQAYRAGVFRK
SSEEEEEEECCCCCCCCHHHHHHHHHHHHHHH
4zcfA582603EH11.97329686.260455177.607019160.237780
SeqKVVFYGSNFSAKQMELNEALKS
SSEEEEEECCCCCHHHHHHHHHHHH
2ejwA224EH10.51812268.957396167.151022141.681852
SeqEALKIALLGGGTVGSAFYNLVLE
SSEEEEEEEEECCCHHHHHHHHHHHH
1i1qB538555EH10.81116586.691315166.485275182.598864
SeqNVVIYRNHIPAQTLIDRL
SSEEEEEEECCCCCHHHHHHH
2olnA223EH10.60058269.570165170.337952157.912823
SeqSYDVVVVGGGPVGLATAWQVAE
SSEEEEEEEECCCHHHHHHHHHHHH
2rjnA102129EH10.14262573.200775169.397614166.905560
SeqRFLLKPWEDEDVFKVVEKGLQLAFLREE
SSEEEEECCCCHHHHHHHHHHHHHHHHHHHH
4nh0A114149EH11.36091768.966285159.081520152.615636
SeqVSAIITNLEEELPLVDRMYDALHGEMVRRQEHLRHS
SSEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
3tsmA138160EH10.43642067.860909171.795271185.702648
SeqCILIIMASVDDDLAKELEDTAFA
SSEEEEEECCCCCHHHHHHHHHHHHH
3wv4A197219EH10.74772266.978786160.599745184.396677
SeqIVFCRMSVSWDFGLYKVLISTLT
SSEEEEECCCCCCHHHHHHHHHHHHH
3cb6A296325EH10.53932581.114865161.393469161.026608
SeqVGRTYLFDPDSEQQKNYSFLVALQKKLFEY
SSEEEEEEEECCCHHHHHHHHHHHHHHHHHHHH
3cf4A204224EH10.73598284.081694162.283877143.489539
SeqFLCVIGHNVAGVTYMMDYMED
SSEEEEEECCCCHHHHHHHHHHHH
3eulA101121EH11.00845671.352913169.848064166.484736
SeqGFLLKDSTRTEIVKAVLDCAK
SSEEEEECCCCHHHHHHHHHHHHH
3l8kA224EH11.32356472.001642162.179197173.737136
SeqLKYDVVVIGAGGAGYHGAFRLAK
SSEEEEEEEEECCCHHHHHHHHHHHH
1yvuA318331EH10.48481277.216603169.395277159.888934
SeqNTKVITNLRKFLEL
SSEEECCCCCCHHHHHH
3h4tA286302EH10.23768068.761965170.130340151.831665
SeqAVVHHGGAGTTTAVTRA
SSEEEEECCCHHHHHHHHHH
3qhoA67112EH10.56461988.040961158.517327174.947599
SeqAIRLPFCTESVKPGTQPIGIDYSKNPDLRGLDSLQIMEKIIKKAGD
SSEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
3aiaA151171EH11.75586481.372067161.542973152.900777
SeqPVFIIGDHIGIGEEDERFLDE
SSEEEEEEECCCCCCHHHHHHHHH
4ja2A99118EH10.68892779.196901169.801558151.657522
SeqKVMRKPFSPSQFIEEVKHLL
SSEEEEECCCCHHHHHHHHHHHH
4xywA173194EH10.36904096.146554167.707756161.275923
SeqKVLFVGRLTHPKRPELLANVIS
SSEEEEEECCCCCCCCHHHHHHHHH
4j27A312346EH11.93312367.565011157.753795178.622228
SeqNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKA
SSEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHH
1ceoA4480EH10.79229476.048923172.447231153.932235
SeqHVRLPFDYPIIESDDNVGEYKEDGLSYIDRCLEWCKK
SSEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
4i6jB697714EH11.92731789.664112167.355787128.986073
SeqELALNYHLLSDELLLALS
SSEEEEEECCCCCHHHHHHHH
3r4cA118135EH11.81430771.148989157.980176129.579781
SeqGVFVNRLTPTVEQIAGIV
SSEEEEECCCCHHHHHHHHHH
4dadA103125EH10.40189083.788800170.682675178.163475
SeqVRDVLRWPLEPRALDDALKRAAA
SSEEEEEEECCCCHHHHHHHHHHHHH
3geeA266291EH10.57418082.888783168.245708184.106342
SeqLILYLLDLGTERLDDELTEIRELKAA
SSEEEEEEEECCCCCCHHHHHHHHHHHHH
3h4sA5267EH10.81674271.045628175.837695163.269656
SeqRVFDMRASQDDIFEDT
SSEEEECCCCCHHHHHHHH
5a34B183207EH11.11973393.582836157.791682147.754373
SeqDIVINANPASPPLSLLVLHRLLCEH
SSEEEEEEECCCCCCHHHHHHHHHHHHH
1c3pA161178EH11.04533091.963654169.331514177.313701
SeqILYIDLDAHHCDGVQEAF
SSEEEEEECCCCCCHHHHHHH
2p0oA3353EH11.12875074.464404168.516895127.603157
SeqSLHIPLYRQRLTDLGAIAKAE
SSEEECCCCHHHHHHHHHHHHHHH
4zurA189206EH10.81453890.440142168.831585173.581820
SeqIAILDVDFHHGNGTQDIF
SSEEEEEECCCCCCHHHHHHH
3urrA98125EH10.57870992.634113177.789509152.993072
SeqVSLLIFLLVPEQATQAHLEILSEIAQLL
SSEEEEEEEEEEECCCCHHHHHHHHHHHHHH
4fidA179208EH10.37696174.502962160.667365184.822177
SeqCAIFVTSLAEYDKLYGNTSRLTESIAVFKD
SSEEEEEEEECCCCCCCCCCCCHHHHHHHHHHH
4do4A98130EH10.11790570.332921161.869482178.841429
SeqKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAE
SSEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHH
5ep0A98120EH10.59724575.471556173.133910125.046671
SeqDFLIKPCEADRLRITVNKALKAE
SSEEEEECCCCHHHHHHHHHHHHHHH
2qv0A97121EH10.18192682.620605163.989679166.170356
SeqDYILKPYQESRIINMLQKLTTAWEQ
SSEEEEECCCCHHHHHHHHHHHHHHHHH
4cngA105123EH11.54752271.332851173.876003182.667377
SeqKVAFIFGRESVGLTREEIA
SSEEEEEEECCCCCCCCHHHHH
5es8A323EH10.71564194.457857169.004217177.823487
SeqRILFLTTFMSKGNKVVRYLES
SSEEEEEECCCCCCCCHHHHHHHH
1zkpA5987EH11.83362394.594879170.028332133.511733
SeqAVVLSHYHHDHVADIGVLQYARLITSATK
SSEEEECCCCCCCCCCCHHHHHHHHHHHHHHH
2x3lA138162EH11.22519194.547489176.252177182.016662
SeqLVVLTYPNYYGETFNVEEVIKSLHQ
SSEEEEEECCCCCCCCCCHHHHHHHHHH
1a9xA929951EH10.58453388.768049177.008636176.748778
SeqRALLSVREGDKERVVDLAAKLLK
SSEEEEEECCCCCCCCHHHHHHHHHH
1w4xA728EH10.49807367.281525167.100682155.620324
SeqEVDVLVVGAGFSGLYALYRLRE
SSEEEEEEEECCCHHHHHHHHHHHH
1y7lA6282EH10.85486468.637075168.453268172.063530
SeqEIVDATSGNTGIALAYVAAAR
SSEEEEECCCCHHHHHHHHHHHHH
5fmrA3247EH10.32826468.267053164.096179164.892592
SeqRPDKVDKDDFTLDTLR
SSEEEEEECCCCCCHHHHH
2b7kA128151EH10.14437571.178226165.247316153.826755
SeqFVDALGRNYDEKTGVDKIVEHVKS
SSEEEEEECCCCCCCHHHHHHHHHHHH
4k22A222EH10.74743569.366696163.578716128.472754
SeqQSVDVAIVGGGMVGLAVACGL
SSEEEEEEEEECCCHHHHHHHHHH
3thdA5185EH10.67765385.211779177.657835127.194493
SeqAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHE
SSEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
3k7yA209235EH10.82044480.432265161.376480176.159257
SeqVIIFDIAYQGFGHTNLEEDVLLIRKFE
SSEEEEEEECCCCCCCCCCCHHHHHHHHHH
3c8fA163190EH11.17703882.175026175.818448159.069490
SeqVWIRYVVVPGWSDDDDSAHRLGEFTRDM
SSEEEEEEEECCCCCCCHHHHHHHHHHHHHH
1rw1A97110EH10.41426881.383746164.075153172.675982
SeqTLVGFKPDAYAAAL
SSEEEECCCHHHHHHHH
4locA180202EH10.09403972.182431171.555768136.302114
SeqLFRVFDCLNWVENMRVSMDAIAE
SSEEEEECCCCCCCCCCHHHHHHHHH
1kafA5673EH10.14683979.704111164.641363137.131151
SeqNMRIFGYKMMEHHIQKFT
SSEEEEEEEECCCHHHHHHHH
2aefA218EH10.43152869.562648164.502254133.965354
SeqHVVICGWSESTLECLRE
SSEEEEEECCCHHHHHHHHH
1kzyC409431EH10.35459274.836179175.318327175.863344
SeqYAFLLTMATIPPFNKQYTESQLR
SSEEEEEECCCCCCCCCHHHHHHHHH
1a9xB14031435EH10.16864894.171492165.825222184.169822
SeqAFSFQGNPEASPGPHDAAPLFDHFIELIEQYRK
SSEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHH
2w2kA164183EH10.78285972.843490176.831563171.142416
SeqVLGAVGLGAIQKEIARKAVH
SSEEEEEECCCHHHHHHHHHHHH
4bg2A135155EH10.58180377.518960158.203603130.783167
SeqYIHIKPEEDTEELARTALVLD
SSEEEEECCCCCCHHHHHHHHHHH
1gudA222238EH10.18593984.539149157.350351174.072065
SeqLVVGTDGIPEARKMVEA
SSEEEEEECCCHHHHHHHHH
1pg4A130151EH10.40830169.482532166.304574170.025810
SeqVVAIYMPMVPEAAVAMLACARI
SSEEEEEECCCCHHHHHHHHHHHHH
4at0A1436EH11.46605470.535612172.159385154.114496
SeqYEADVVVAGYGIAGVAASIEAAR
SSEEEEEEEEECCCHHHHHHHHHHHH
4rlqA6080EH10.12691672.976415163.453019175.088394
SeqRVLLLMLDGTDWPVAFLGAIY
SSEEEEEECCCCCHHHHHHHHHHH
2oc3A169204EH11.43925467.268335175.019781158.484105
SeqESRSVYQLQYMSWPDRGVPSSPDHMLAMVEEARRLQ
SSEEEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHH
2eq6A224EH11.60924269.063867168.213560166.125276
SeqKTYDLIVIGTGPGGYHAAIRAAQ
SSEEEEEEEEECCCHHHHHHHHHHHH
4w5zA163185EH11.45631271.252259169.143701143.390074
SeqMITMAPEFPYLTANGAYTPYLTE
SSEEEEECCCCCCCCCCCCCHHHHHH
3jrnA328EH11.09145793.759304174.571244181.320391
SeqYDVFLSFRGHDTRHNFISFLYKELVR
SSEEEEEEEECCCCCCCCHHHHHHHHHHH
4yx6A160179EH11.03205394.167870162.466677164.429607
SeqTVEASAFLGLTPQIVYYRAA
SSEEEEEECCCCCCHHHHHHHHH
3igzB272291EH10.97224471.096990169.087885153.761771
SeqAVLCVNFRGDRVIEMTRAFE
SSEEEEECCCCCCCCHHHHHHHH
3c3pA144168EH10.92029886.070748163.893130153.343211
SeqLAKNALLIAVNALRRGALREFNHHL
SSEEEEEEEEEEECCCCCCCCCHHHHHH
1y8qA119139EH10.51699776.600002179.012357162.882554
SeqAVCLTCCSRDVIVKVDQICHK
SSEEEEEECCCHHHHHHHHHHHHH
3ux8A165178EH11.01035968.669825161.219172157.612102
SeqTLIVVEHDEDTMLA
SSEEEEEECCCHHHHHH
4kpoA324EH11.07551068.540456167.268808185.900688
SeqSKIIIDTDPGIDDSVAILMAFQ
SSEEEEEEEECCCHHHHHHHHHHHH
3s28A548570EH10.71840491.678212166.537095125.618103
SeqILFTMARLDRVKNLSGLVEWYGK
SSEEEEEECCCCCCCCHHHHHHHHHH
1gpjA169189EH10.11199770.509313165.727599169.836567
SeqTVLVVGAGEMGKTVAKSLVDR
SSEEEEEECCCHHHHHHHHHHHHH
3ezsA109126EH10.49364273.893418176.448946173.620359
SeqTIAYPNPFYQIYEGAAKF
SSEEEECCCCCCCHHHHHHHH
3ngqA211231EH10.93139883.022201163.633202126.494157
SeqLVLCADLNSLPDSGVVEYLSN
SSEEEEEEECCCCCCCHHHHHHHH
4q7eA99121EH10.42335577.631375173.702042184.073138
SeqEFIPKPFHLKEFLIRLERVISLT
SSEEEEECCCCHHHHHHHHHHHHHHH
3qekA163185EH10.32560494.003279178.628094184.409348
SeqKADKVLQFEPGTKNLTALLLEAK
SSEEEEEEEEECCCCCCCHHHHHHHH
2p3nA191211EH11.62006291.237170157.011829183.159502
SeqFFVTWRINPWDIAAGLIIVKE
SSEEEEEECCCHHHHHHHHHHHHH
3ipcA171191EH11.29091185.362844176.971973139.343266
SeqMYEGVNVGDKDFSALISKMKE
SSEEEEECCCCCCCCHHHHHHHHH
3g85A120143EH11.50874087.287855168.311996181.178050
SeqAAILTESLNDADNRNKGFIETCHK
SSEEEEECCCCCCCCHHHHHHHHHHHH
1c4kA213228EH10.47211769.260087169.237988168.923664
SeqLVLFDRNNHKSVYNSA
SSEEEEEECCCCHHHHHHH
2x3nA223EH11.01194170.970216166.858852165.059599
SeqHIDVLINGCGIGGAMLAYLLGR
SSEEEEEEEECCCHHHHHHHHHHHH
2r76A224EH10.25539072.395904171.314012133.267204
SeqQLSLSSSDEYKELTRLVRERLRL
SSEEEEEEECCCCCHHHHHHHHHHHH
1e3pA499514EH10.94031578.672147167.814307158.023474
SeqTHYVALTDILGAEDAF
SSEEEEEEEECCCHHHHHH
3lfjA425EH10.77385994.035729172.380888155.222348
SeqWKIVFARIDDRLIHGQVMTRWM
SSEEEEEEEEEECCCCCCCHHHHHH
3on5A176197EH10.23481790.071468176.493728128.960989
SeqERLIIFGAGPDVPPLVTFASNV
SSEEEEEEECCCCCHHHHHHHHHHH
4k8gA242259EH11.23869379.678824159.385996157.621596
SeqLAVGEIFNTIWDAKDLIQ
SSEEEECCCCCCCCCCHHHHH
4dg8A6383EH10.41987068.571000172.069318176.939528
SeqCLGVYGEYSRESITCLLAILL
SSEEEEEECCCCHHHHHHHHHHHH
4wfoA588618EH10.12528372.518874163.872896145.248802
SeqVRLLIEDYPYAADGLEIWAAIKTWVQEYVPL
SSEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHH
4fzrA325EH10.68323793.912048176.095256160.431133
SeqILVIAGCSEGFVPLVPLSWALRA
SSEEEEECCCCCCCCCCHHHHHHHHH
4g4gA306334EH10.67247279.106266173.883268181.758628
SeqMGFSLVGGHNHCQFPSSQNQDLNSYINYF
SSEEEEEECCCCCCCCCCHHHHHHHHHHHHHH
3hdvA97116EH10.19109192.645079160.201629161.884525
SeqDFLLKPVDLGKLLELVNKEL
SSEEEEECCCCHHHHHHHHHHHH
1rsgA224EH11.12708469.918059165.863993134.979430
SeqAKKKVIIIGAGIAGLKAASTLHQ
SSEEEEEEEEECCCHHHHHHHHHHHH
5ce6A282311EH10.35307380.553951159.309289168.431030
SeqIARTFLIDADPIQSKAYEVLLKAQEAVIGS
SSEEEEEEEECCCHHHHHHHHHHHHHHHHHHHH
4ntcA1234EH11.37814172.928595166.989548152.653680
SeqLLVDVLIIGAGPAGLSTATGLAR
SSEEEEEEEEECCCHHHHHHHHHHHH
4xsoA394410EH10.47424684.751617165.837166156.176432
SeqALVGLFADGAFKTLLEQ
SSEEEEEECCCCHHHHHHHH
3clwA64115EH10.24173676.697419162.518208175.905409
SeqWRVNIGAGSYENREAKEVDNSWNRTECFLSPDGKYDFTKQAGQQWFMKAARE
SSEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
1wyzA128155EH11.73867371.103264166.102342174.312237
SeqFAFHGYLPIEPGERAKKLKTLEQRVYAE
SSEEEEEEECCCCCCHHHHHHHHHHHHHHHH
5ikkA157174EH11.25687689.059398168.903304181.109716
SeqVLIVDWDIHHGNGTQMAF
SSEEEEEECCCCCCHHHHHHH
5hsgA211227EH10.46541488.806890158.058774176.435380
SeqKVFGWDLTAKAISGIDG
SSEEEEEECCCHHHHHHHHH
1snyA3050EH10.72918395.425095157.033171169.722078
SeqHLFTTCRNREQAKELEDLAKN
SSEEEEEEECCCCCCHHHHHHHHH
1m22A78115EH11.60011296.424510169.946688177.706525
SeqPLLLKDNINAAPMATSAGSLALQGFRPDDAYLVRRLRD
SSEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH
3lufA214237EH10.49532577.048967172.510468185.572123
SeqDFLNQPFEPEELQCRVSHNLEALE
SSEEEEECCCCHHHHHHHHHHHHHHHH
2i5gA173199EH11.26728867.818670158.931561149.332957
SeqCYSHCLPSGLKEHPRNKSDEELKFIAD
SSEEEEEECCCCCCCCCCCCCHHHHHHHHH
2gj4A530560EH11.65369695.192674157.904725161.385785
SeqLFDVQVKRIHEYKRQLLNCLHVITLYNRIKK
SSEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHH
1z0sA2639EH10.92546787.153235158.792755181.322201
SeqEVELFNQPSEELEN
SSEEEEEECCCCHHHHH
4aibA134158EH10.73354694.776793178.698533158.694762
SeqGIMIRIMKFGLHDDEVEIVLKEIKD
SSEEEEEEECCCCCCCCHHHHHHHHHHH
2w37A160182EH10.10565583.050771161.878055181.309726
SeqTLTFMGDGRNNVANSLLVTGAIL
SSEEEEEECCCCCHHHHHHHHHHHHH
3biqA295324EH10.61950380.784722165.388745152.026078
SeqITRTFLIDPSEEMANNYDFLLTLQKEIVTN
SSEEEEEEEECCCHHHHHHHHHHHHHHHHHHHH
4ldaA98117EH11.76863166.627583176.479182170.446466
SeqDFITYGARASELTGLIRRLG
SSEEEECCCCCHHHHHHHHHHHH
4zdlA146163EH11.08179881.015664171.873601181.081643
SeqYIIWPRIDQKSCFKSMIT
SSEEEEEECCCCHHHHHHHHH
2f51A88110EH11.71997693.752706166.286233148.891000
SeqEIKTLDQFVGADVSRIKADIEKF
SSEEEEEEEEEECCCHHHHHHHHHHH
3bc8A135152EH10.92313180.898440172.706525175.772500
SeqYIIWPRIDQKSCFKSMVT
SSEEEEEECCCCHHHHHHHHH
4oo3A1324EH11.09742379.186553173.263325177.005925
SeqITLDPGHFHAAL
SSEEEECCCCHHHHH
2an1A422EH10.13810275.563186174.911237140.628065
SeqCIGIVGHTTHEMLYRWLCD
SSEEEEEECCCHHHHHHHHHHH
2fnuA7693EH10.33736282.094153169.722461155.831901
SeqEIITTPISFVATANMLLE
SSEEEEECCCCCCHHHHHHHH
4wd3A223EH10.58825471.870092157.350869156.986278
SeqRILLINSDKPEPIQFFQKDKET
SSEEEEEECCCCHHHHHHHHHHHHH
5bzaA523EH10.78262173.655189166.480991151.210301
SeqFFCGFDDFNEEAREVIQKY
SSEEEEEECCCCHHHHHHHHHH
4ru1A129152EH10.13781167.007298174.647064130.033059
SeqHVLCVLQAQGQVQLESRCNGVQQT
SSEEEEEEECCCCCHHHHHHHHHHHHH
3ni2A118138EH10.28511689.251994161.881541165.488026
SeqAKLLITQACYYEKVKDFARES
SSEEEEEEECCCCCHHHHHHHHHH
4cy8A224EH11.37767970.377831163.886383161.915180
SeqAETDVLIVGAGPAGAMSATLLAS
SSEEEEEEEEECCCHHHHHHHHHHHH
3bilA202215EH10.61589683.207115160.037567148.346903
SeqVSVIGFDTHPLFAL
SSEEEEEEECCCHHHHH
2e7zA103126EH10.68941495.168056171.776537144.598960
SeqLGVSQTEINQQSEYGTLRRFMNLL
SSEEEEEECCCCCCCCCCHHHHHHHHH
2oktA123140EH10.56301674.551636164.501776182.860060
SeqGATASGLSNKQLESLKAT
SSEEEEECCCCHHHHHHHHHH
2q40A194220EH10.90181694.747123177.169012155.084317
SeqKAVIFVDNSGADIILGILPFARELLRR
SSEEEEEECCCCCCCCCCCHHHHHHHHHHH
2r0cA426EH11.50572667.791515165.511506149.243621
SeqIETDVLILGGGPVGMALALDLAH
SSEEEEEEEEECCCHHHHHHHHHHHH
1eluA94116EH10.62271783.733183164.911588179.267908
SeqEILLTDCEHPGIIAIVQAIAARF
SSEEEEEECCCCHHHHHHHHHHHHHH
5djsA163187EH10.56543170.493355165.072231134.337439
SeqLRIGYVSGELRCHPVGYFLEPVIEA
SSEEEEEEEECCCCCCHHHHHHHHHHHH
From residue 68 to 83 type HE
jmol
SSEHHHHHHHCCEEEEEEE
Distance8.430270Delta74.310753
Theta135.513624Rho80.876953
Geometrically equivalent Smotifs
PDBChainStartEndTypeDDeltaThetaRho
3zhoA6275HE7.90962662.206364133.14521472.712463jmol
SeqQELADYDAIIFGTP
SSEHHHHHCCEEEEEEE
2ddrA5168HE8.72951577.575944147.16631050.053923jmol
SeqNSASDRLLGNLKKEYPNQ
SSEHHHHHHHHHHHCCCCCEE
1m3sA2443HE8.64791785.895844127.950085106.214891jmol
SeqNEEADQLADHILSSHQIFTA
SSEHHHHHHHHHHHHHCCCEEEE
3u48A528539HE7.48366981.280956133.44647774.565679jmol
SeqTWEHENVPAILN
SSEHHHHHHCCEEEE
1kblA432446HE7.84351187.656035137.47346059.107090jmol
SeqPEDIEGMHAAEGILT
SSEHHHHHHHHHCCEEEE
3k35A1337HE8.66454582.907645130.68349694.565830jmol
SeqPEELERKVWELARLVWQSSSVVFHT
SSEHHHHHHHHHHHHHHHHHCCCEEEEE
1vl0A163174HE7.83299588.679857143.25255957.888660jmol
SeqNLGKTHDELKVV
SSEHHHHHCCEEEEE
3e39A6984HE7.47865862.614696121.67078190.735921jmol
SeqGHIVRGAKVIILVFLD
SSEHHHHHHCCEEEEEEEE
1ur1A2641HE8.66338680.370168125.34397065.492682jmol
SeqERLNTLIAKEFNSITP
SSEHHHHHHHHHHCCEEEE
4yt2A7688HE8.07963279.833179149.06443060.101784jmol
SeqDVEAAKHGEIHVL
SSEHHHHHHHCCEEEE
2dy1A80101HE7.57610775.838490139.92016669.113426jmol
SeqGDFVGEIRGALEAADAALVAVS
SSEHHHHHHHHHHHHHCCEEEEEEE
2uz1A190210HE7.77953177.886922130.569844107.695583jmol
SeqPADLDQALALLRKAERPVIVL
SSEHHHHHHHHHHHHHCCCEEEEE
3hf5A90110HE8.66107180.435267130.31218860.300052jmol
SeqDIRKAWFEHGKYFIGQLKPFV
SSEHHHHHHHHHHHHHCCEEEEEE
3s1sA572590HE9.42761467.010778123.584683111.442182jmol
SeqNGRVAEEWITNNLESHCIR
SSEHHHHHHHHHHHHCCCCEEE
5d1pA130147HE8.31022488.694424143.08935257.378849jmol
SeqSEFFREHPDLVICGEMIG
SSEHHHHHHCCCEEEEEEEEE
3jtmA214226HE7.69363175.102256142.22905093.750085jmol
SeqLNEMLPKCDVIVI
SSEHHHHHHHCCEEEE
3wndA6582HE7.70602670.920107140.46273582.215546jmol
SeqLKSLITALNISDIAVLCI
SSEHHHHHHHHHHCCEEEEEE
2wzbA306325HE7.60466862.891853135.09991088.522847jmol
SeqPESSKKYAEAVTRAKQIVWN
SSEHHHHHHHHHHHHHCCEEEEE
1ua4A272290HE7.61139187.425969140.05197783.391514jmol
SeqEKVREEILNVLGMFYSVGL
SSEHHHHHHHHHHHHHCCEEEE
1m2kA165184HE7.61740964.018255124.625608104.481649jmol
SeqPDVLDRAMREVERADVIIVA
SSEHHHHHHHHHHHHHCCEEEEE
1vhtA163175HE8.05251882.425363142.53225577.275189jmol
SeqREARLAVADDVID
SSEHHHHHHHCCEEEE
4bv6A161180HE8.15276684.998973140.299524111.443622jmol
SeqIGDFRSLEKISREVKSITII
SSEHHHHHHHHHHHHHCCEEEEE
5i45A100113HE7.83090564.453258124.75448091.014478jmol
SeqEIPSWYRALDIVVC
SSEHHHHHHHHCCEEEE
2d1pC328343HE9.02768981.534156122.49317680.377117jmol
SeqYTDFVRLTVKHPSQMA
SSEHHHHHHHHHHCCCEEE
3bb8A147164HE7.54588265.185195142.611982106.172561jmol
SeqASLIEAAVSDKTKAIMIA
SSEHHHHHHHCCCCEEEEEEE
4ezeA265275HE8.18826776.921478144.794130101.105148jmol
SeqPVVREKIHHQI
SSEHHHHHHCCEEE
3ulkA91103HE7.78869280.412592138.88296697.796692jmol
SeqYEELIPQADLVIN
SSEHHHHHHHCCEEEE
1g8kA682698HE8.83365679.911419135.55915560.433995jmol
SeqATVQQQKDKYRFWLNNG
SSEHHHHHHHHHCCEEEEEE
3vqfA6483HE7.63994361.820979146.19500371.724326jmol
SeqPESAAHLIQASERRVHLVVS
SSEHHHHHHHHHHCCCEEEEEEE
1us5A177190HE7.58955588.843880129.765799105.993211jmol
SeqSAIQQLALTTPIAL
SSEHHHHHHHHHCCEEE
2o4cA161173HE8.17755382.887281146.71780880.977102jmol
SeqLERLLAEADVISL
SSEHHHHHHHCCEEEE
3gf8A235251HE8.67279163.991257121.68120488.472182jmol
SeqTQEYLDRQSNYHIIFFL
SSEHHHHHHHCCEEEEEEEE
4ccdA221236HE8.29000577.644570135.07754276.737256jmol
SeqWNAKMSGKKLWSSEDF
SSEHHHHHHCCEEEEEEEE
3kb6A183195HE8.03034177.549981146.20488996.036622jmol
SeqLDELLKESDVISL
SSEHHHHHHHCCEEEE
1e6cA125152HE7.95656874.841866135.95912277.849301jmol
SeqGRPIAEEMEAVLREREALYQDVAHYVVD
SSEHHHHHHHHHHHHHHHHHHHHHHCCEEEE
3n29A86101HE7.97229281.899519142.90091785.525147jmol
SeqEDEIGEIASLSHHIVF
SSEHHHHHHHHHHCCEEEE
1uwcA166191HE8.74976882.790378121.784780108.206544jmol
SeqQAFASYMNDAFQVSSPETTQYFRVTH
SSEHHHHHHHHHHCCCCCCCCCCEEEEEE
2r2jA823HE7.58416872.690252150.123150111.125644jmol
SeqIDEILNNADVALVNFY
SSEHHHHHHHCCEEEEEEE
1ytlA926HE7.51085879.177931127.691858100.209694jmol
SeqGKPVANMIKKAKRPLLIV
SSEHHHHHHHHHHCCCEEEEE
4tmxA85106HE7.76551274.406079142.17759869.908607jmol
SeqESFSNLRSRGSSLCNIAILVVD
SSEHHHHHHHHHHHHHCCEEEEEEE
1f0xA314331HE7.98276580.795582136.82243352.493227jmol
SeqPRMKNWRDKYEHHLLLKM
SSEHHHHHHHHHCCEEEEEEE
4fglA82102HE7.73016470.587378127.85293977.267639jmol
SeqSDITDEQKKVREADLVIFQFP
SSEHHHHHHHHHHHHCCEEEEEEE
4e5nA194206HE7.93443278.589293146.73815893.847521jmol
SeqCSELFASSDFILL
SSEHHHHHHHCCEEEE
1xdwA192204HE8.07840881.633818147.35815588.965363jmol
SeqLDEVLEKSDIITI
SSEHHHHHHHCCEEEE
3bbdA144156HE8.16468276.721204126.22558570.242548jmol
SeqPKLLKEYDTFIIG
SSEHHHHHHCCEEEEE
1f0kA242254HE8.22025983.015732132.21574958.047488jmol
SeqMAAAYAWADVVVC
SSEHHHHHHHCCEEEE
1eg5A258273HE9.02537767.915899141.341219106.989375jmol
SeqKLRSKLVSGLNLGAHI
SSEHHHHHHHHHCCCCCEE
3afoA104118HE8.52659174.288059121.91484570.689459jmol
SeqEQDIVNRTDLLVTLG
SSEHHHHHHHCCEEEEEE
3otgA283295HE8.35163486.609051138.71964980.145119jmol
SeqQAALLPHVDLVVH
SSEHHHHHHHCCEEEE
2va8A112122HE8.38060477.438173140.09433369.500456jmol
SeqAWLKNYDIIIT
SSEHHHHHCCEEEE
2i44A176188HE7.67594071.025371129.96686499.908203jmol
SeqHEKLRIRNGGSVE
SSEHHHHHCCCCCEEE
4ehxA174186HE7.63131769.556183129.48881075.427742jmol
SeqLKEIRRADALVLT
SSEHHHHHHCCEEEEE
1t6t1422HE7.75820560.823945123.37673594.751375jmol
SeqLSEWIKELKKASREAVILV
SSEHHHHHHHHHHHCCCCEEEE
2o3jA7890HE8.08360479.849366146.20713595.846729jmol
SeqIPKAIAEADLIFI
SSEHHHHHHHCCEEEE
3nb0A491502HE8.02657176.058084123.34593480.882078jmol
SeqYDEFVRGCHLGV
SSEHHHHHHHCCEEE
2iw1A263275HE8.30920281.799869130.79644174.871979jmol
SeqVSELMAAADLLLH
SSEHHHHHHHCCEEEE
3rt9A103115HE8.10494479.330777124.42146061.774962jmol
SeqPSILNEFDVVVDA
SSEHHHHHHCCEEEEE
3hg7A3550HE8.08920380.900622145.187653100.458215jmol
SeqQSDAEKLIGEAHILMA
SSEHHHHHHHHHHCCEEEE
2ivfA177189HE7.90414874.926152141.69963489.794121jmol
SeqADNLLDAELIFMT
SSEHHHHHHCCEEEEE
3gq8A219HE7.75918781.652346137.23916795.837818jmol
SeqFADLVIQVIDELKQFGVS
SSEHHHHHHHHHHHHCCCCEE
1yc5A420HE8.67200671.849944123.79011398.291612jmol
SeqKEFLDLLNESRLTVTLT
SSEHHHHHHHHHCCCEEEEE
3fg2P129148HE8.93473687.958222141.176392101.574001jmol
SeqLDESEVLRQRMPDKKHVVVI
SSEHHHHHHHHHHHHHCCEEEEE
4psyA97114HE8.36478488.808665138.804849107.218104jmol
SeqGRVYEQFLPKAQKLYLTH
SSEHHHHHHHHHHCCEEEEEE
1fyeA7385HE7.89157677.248914133.961774104.377501jmol
SeqPLAAIEKAEIIIV
SSEHHHHHHHCCEEEE
3snoA195208HE7.82507166.869206129.258853109.230888jmol
SeqIDDLFGADSVWLVS
SSEHHHHHHCCEEEEEE
1pq4A4357HE8.20510976.404937123.04981479.506167jmol
SeqPQQLAALSEAEAYVL
SSEHHHHHHHHHCCEEEE
2oq2A3047HE8.63410586.324512141.67722089.236736jmol
SeqPQEIIAWSIVTFPHLFQT
SSEHHHHHHHHHHHCCCEEEE
4ptzA229249HE8.11223571.310761130.06239099.405535jmol
SeqPALKTFTEQLQQADGLIVATP
SSEHHHHHHHHHHHHCCEEEEEEE
3ix9A102120HE8.39307089.271958138.840163109.909574jmol
SeqKQIFQAFEPYLDEVIVTHI
SSEHHHHHHHHHHCCEEEEEEE
2gj4A618633HE8.26476663.534117126.115483103.067477jmol
SeqVSLAEKVIPAADLSEQ
SSEHHHHHHHHHHCCEEEE
1v1aA173193HE7.72370884.190242143.90069393.472508jmol
SeqPEEARGFLERALPGVDLLFLS
SSEHHHHHHHHHHHHHHCCEEEEE
3okpA125143HE7.82288974.368486129.96702986.914602jmol
SeqPGSRQSLRKIGTEVDVLTY
SSEHHHHHHHHHHHHHCCEEEE
5ca8A95117HE7.69982384.960857132.74858486.863652jmol
SeqQDFERKAALFALSTSEVLIINIW
SSEHHHHHHHHHHHHHHCCEEEEEEE
2eklA3651HE8.17159485.308006143.46786678.316114jmol
SeqKEELLNIIGNYDIIVV
SSEHHHHHHHHHHCCEEEE
2a1rA159174HE7.98984573.019972123.740879107.535054jmol
SeqSRVIHAIANSGKLVIG
SSEHHHHHHHHHHCCEEEE
3sxuA104116HE7.58110367.822094137.77971976.913328jmol
SeqDFATAFTEVVDFV
SSEHHHHHCCEEEEEE
3phhA189204HE7.53642183.638316131.02746883.577308jmol
SeqKEVLKGYFKEGKLAYD
SSEHHHHHHHHHHCCEEEE
4r82A6274HE7.62392775.249835128.544455109.292801jmol
SeqQRLTALPTFAVSV
SSEHHHHHCCEEEEEE
3dtdA93111HE9.35643868.993914124.79792279.209219jmol
SeqKNYVAALRAGKHLKLAMTI
SSEHHHHHHHHHCCEEEEEEEE
4xijA180192HE8.22157180.621127128.26725379.385035jmol
SeqLADAVASADAAVS
SSEHHHHHHHCCEEEE
3h49A124135HE8.36179984.903668132.51164460.698304jmol
SeqFARFSQAKLLSL
SSEHHHHHHCCEEEE
2zxeA709719HE7.59544174.974685137.77485673.589154jmol
SeqDVSKQAADMIL
SSEHHHHHHCCEEE
3pidA344355HE7.75654973.077777130.57814966.700645jmol
SeqLNAFKQEADVII
SSEHHHHHHHCCEEE
1rz4A130149HE8.88373982.444812132.65856550.443348jmol
SeqFEDSVRKFICHVVGITYQHI
SSEHHHHHHHHHHHHHHHHCCEE
3fb9A831HE9.39135263.594833136.17219092.999875jmol
SeqDVAKMKKIKEEIKAHEGQVVEMTL
SSEHHHHHHHHHHHHHHCCCCEEEEEE
3qj4A110124HE8.55870685.925077133.77150091.087741jmol
SeqSIIKHYLKESGAEVY
SSEHHHHHHHHHHCCEEE
1mkzA8596HE7.69940172.327166134.01611684.351157jmol
SeqAPEALLPLFDRE
SSEHHHHHHHHCCEE
3wnvA201213HE7.90174171.046698147.60962593.779277jmol
SeqFDELLAQSDVFSL
SSEHHHHHHHCCEEEE
4bucA189212HE7.77039065.254764145.995282109.367816jmol
SeqFKEYVDSKLKPAFLQTEGDLFVYN
SSEHHHHHHHHHHHHHHCCCCCEEEEE
2ekdA2644HE8.67742082.084127146.88220098.050395jmol
SeqELLLYYIVNNSKLPIVVDD
SSEHHHHHHHHHHCCCCEEEEE
5i7zA7493HE7.44002764.182425135.14213488.027126jmol
SeqLDQVTDMMVANSSNLIITVK
SSEHHHHHHHHHHCCCCEEEEEE
2w5fA177192HE8.70674883.395491132.94473776.047505jmol
SeqSSIKALILREFNSITC
SSEHHHHHHHHHHCCEEEE
4zocA444465HE8.00916681.010753144.99132560.954407jmol
SeqEEDKVAVKAAVQNMDVVVLALG
SSEHHHHHHHHHHHHHCCEEEEEEE
3egwA240252HE8.00495369.044892137.53217399.791362jmol
SeqSADWYNSSYIIAW
SSEHHHHHHCCEEEEE
4xqkA10331055HE7.69171581.442013139.55316378.203082jmol
SeqNAMDGMRQSLLEEFSDIYVLNLK
SSEHHHHHHHHHHHHHCCEEEEEEEE
3hj6A115126HE7.97774674.660345133.56230091.715699jmol
SeqIFELIKKVFHLS
SSEHHHHHCCEEEEE
1gdhA196208HE7.71389975.384023146.16781777.249346jmol
SeqLDSLLSVSQFFSL
SSEHHHHHHHCCEEEE
4g0aA198218HE8.53415676.066142149.08990594.951470jmol
SeqDVHVKELVAELRWQYNKFAVI
SSEHHHHHHHHHHHHHHCCCEEEE
4mtlA146168HE8.36111567.993571147.54809456.736438jmol
SeqLDKLLTTMVYLSQPGTVLLWANK
SSEHHHHHHHHHHHCCCCCEEEEEEE
3mi6A476508HE8.36292685.004395145.17063983.745247jmol
SeqSDQQLELPHRYILGVYQLYARLTQAYPNVLFES
SSEHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEE
3en0A7993HE7.86894569.179261122.26487493.927388jmol
SeqSGYRLFVEQCTGIFM
SSEHHHHHHHHHCCEEEE
3eo7A141155HE8.98889880.304225136.34207372.461806jmol
SeqPALESTQLAIIVTAV
SSEHHHHHCCEEEEEEEE
2qzsA357372HE7.58818566.103956125.48986495.604473jmol
SeqEAFSHRIMGGADVILV
SSEHHHHHHHHHHCCEEEE
1uj2A180191HE7.86880768.010949126.93740389.891098jmol
SeqLPTKKYADVIIP
SSEHHHHHHCCEEEE
4lmpA6172HE7.96023273.238242146.17440891.291952jmol
SeqADQVWADADLLL
SSEHHHHHHHCCEEE
4xr9A8696HE7.80201479.400451138.917743104.748026jmol
SeqDPVGAADVVIV
SSEHHHHHCCEEEE
1xv5A127139HE7.73166574.458462138.900284105.103827jmol
SeqLEETVRRADVIFS
SSEHHHHHHHCCEEEE
2wdcA150164HE8.26403379.293096137.546334105.905033jmol
SeqRERVEELLGLFRGEF
SSEHHHHHHHHHHCCCEE
3gvxA164176HE8.07896485.170610147.47734857.877877jmol
SeqPADLFRQSDFVLI
SSEHHHHHHHCCEEEE
3gfsA5070HE9.25558775.521651123.563658102.839525jmol
SeqLKVQELKQRVTKADAIVLLSP
SSEHHHHHHHHHHHHCCCEEEEEE
4u7lA7181HE8.70336272.569496121.645707104.594426jmol
SeqGAASSHVVSLF
SSEHHHHHHCCEEE
2vbfA188211HE8.30137784.066858134.820749109.614051jmol
SeqTTEQVILSKIEESLKNAQKPVVIA
SSEHHHHHHHHHHHHHHHHCCCEEEEE
4zkqA3146HE8.88858587.864472148.28443277.329427jmol
SeqVEDIITQTCDKITYGP
SSEHHHHHHHHCCEEEEEE
1ihjA7393HE8.08590261.782718140.10202958.944889jmol
SeqEQAVIDLIKEADFKIELEIQT
SSEHHHHHHHHHHCCCEEEEEEEE
4bjhB621633HE7.70376683.686167143.99706163.662676jmol
SeqVDKGIDWADVVIW
SSEHHHHHHHCCEEEE
2iyvA124148HE9.23093285.839693147.910935111.785537jmol
SeqRAEKYRALMAKRAPLYRRVATMRVD
SSEHHHHHHHHHHHHHHHHHHHCCEEEE
5fs8A163182HE8.02611685.441026139.604443111.255964jmol
SeqIGDFRSLEKISREVKSITII
SSEHHHHHHHHHHHHHCCEEEEE
3w25A3347HE8.17414977.058496132.62638768.530586jmol
SeqPHAQLTAKHFNMLVA
SSEHHHHHHHHHCCEEEE
3l1wA151160HE8.26134487.034482128.14138197.073024jmol
SeqHDKIAQYPTL
SSEHHHHHHCCEE
4l22A573588HE8.31037966.522661128.787759111.702284jmol
SeqVTVAEKLIPATDISEQ
SSEHHHHHHHHHHCCEEEE
3mt1A8294HE8.15437588.789560143.12649052.895511jmol
SeqIDEVVSHADKIIF
SSEHHHHHHHCCEEEE
4zoeA444465HE8.01211681.457432144.82707561.084817jmol
SeqEEDKVAVKAAVQNMDVVVLALG
SSEHHHHHHHHHHHHHCCEEEEEEE
3smpA3651HE7.84509866.388791131.33587174.298721jmol
SeqENLKSIRKYLTSNTAY
SSEHHHHHHHHHHHHCCEE
3gg2A7183HE8.15475586.619262150.28314173.383943jmol
SeqIEQAVPEADIIFI
SSEHHHHHHHCCEEEE
1bx4A204220HE8.31292180.115417135.68707598.435966jmol
SeqKESLMKVMPYVDILFGN
SSEHHHHHHHHHHCCEEEEE
5fs9A162181HE8.21144287.141122142.085584109.156560jmol
SeqIGDFRSLEKISREVKSITII
SSEHHHHHHHHHHHHHCCEEEEE
3evtA185196HE7.95015273.284597130.53499386.744281jmol
SeqADALATANFIVN
SSEHHHHHHCCEEEE
3r7fA197209HE7.93367288.026704150.24604988.928432jmol
SeqMDEAVESSDVVML
SSEHHHHHHHCCEEEE
3mw6A7184HE8.76397070.757173132.17499791.801327jmol
SeqPRYLKALARGGKRF
SSEHHHHHHHHHCCEEE
4dgsA2443HE8.23266685.939285122.433608110.434615jmol
SeqAADRPALEAALPSIRAVATG
SSEHHHHHHHHHHHHHCCEEEEE
2fueA2139HE7.55897359.528055135.84944091.078719jmol
SeqPEVAAFLQKLRSRVQIGVV
SSEHHHHHHHHHHCCCCEEEEE
2p5sA5472HE7.66144069.181800137.62443498.385304jmol
SeqRSIAKSYFRKADGVLLLYD
SSEHHHHHHHHHHCCEEEEEEE
2dyiA2535HE8.19987474.480650128.50141083.079554jmol
SeqPVVLHLERVYV
SSEHHHHHCCEEEE
2i02A5269HE8.14407389.238748133.74925377.152662jmol
SeqHKVTEIEHHEQVNVSFSS
SSEHHHHHHHHCCEEEEEEEE
1g8kA216228HE7.46890367.499494129.253615109.311202jmol
SeqYEDAQLADVIWSI
SSEHHHHHHCCEEEEE
4xsoA620631HE7.62089377.709050131.36753266.153693jmol
SeqIPQLMAACDLVA
SSEHHHHHHHCCEEE
3drwA215230HE7.82118181.877472125.28754762.526387jmol
SeqKPFLGEIGKEVDGAIF
SSEHHHHHHHHHHCCEEEE
4dimA3747HE7.72744074.552706124.03184861.495485jmol
SeqKPCLNLADEIS
SSEHHHHHHCCEEE
1yqtA194210HE8.56432380.117621143.55180650.485836jmol
SeqLAVLDYLSDIIHVVYGE
SSEHHHHHHHCCEEEEEEEE
4litA318330HE7.51661473.069696144.31731384.291338jmol
SeqRPALDALASNIAL
SSEHHHHHHHHHCCEE
5ahkA187207HE7.66733572.714918126.399640101.588732jmol
SeqMSDLDFIINKLQNAKKPLLLI
SSEHHHHHHHHHHHHHCCCEEEEE
4bfcA100112HE7.83906077.815408146.28050876.724851jmol
SeqLWLWYALSQVCFV
SSEHHHHHHHCCEEEE
3ar4A663677HE8.64409278.324589120.855776101.914649jmol
SeqLAEQREACRRACCFA
SSEHHHHHHHHHHCCEEE
1r7lA4866HE7.90280560.875185147.01160684.795939jmol
SeqIESAWQVVEKLEYDVKVTK
SSEHHHHHHHHHHCCCEEEEEE
3ny7A6183HE8.93951574.638077146.238163100.427776jmol
SeqAGGLDAFQRFVKRLPEGCELRVC
SSEHHHHHHHHHHHHHCCCCCEEEEE
2qs9A115130HE7.80377981.029108124.14805258.042641jmol
SeqWEKIKANCPYIVQFGS
SSEHHHHHHHCCEEEEEEE
3m84A4864HE7.92425185.089150121.76962657.167716jmol
SeqKNIINNYDDPVLVQSID
SSEHHHHHHCCCEEEEEEEE
1jkxA94108HE8.46519178.151563122.85712687.676306jmol
SeqPAFVSHYAGRLLNIH
SSEHHHHHHCCCCEEEEE
2gcgA198210HE7.96626680.980317145.85570586.645979jmol
SeqTPELAAQSDFIVV
SSEHHHHHHHCCEEEE
4prkA192204HE7.75493276.156342145.06923898.693391jmol
SeqFDTVLKEADIISL
SSEHHHHHHHCCEEEE
1oboA4157HE8.01182467.169519142.89115251.179390jmol
SeqVTDLNDYQYLIIGCPTL
SSEHHHHHHCCEEEEEEEEE
3n75A246262HE8.89763787.429016147.19996698.836459jmol
SeqKSLTHLMMMSDVTPIYF
SSEHHHHHHHHHCCCEEEEE
5c78A517538HE8.49337062.536677147.55470683.988242jmol
SeqTQSEAKIMDEIYKISKDKTMII
SSEHHHHHHHHHHHHHHCCCCEEEE
3c3dA171185HE8.35628475.874890123.96785983.881378jmol
SeqPKVLEAFEKEENILI
SSEHHHHHHHHHCCEEEE
3fduA112125HE7.49872775.766478139.419705106.485009jmol
SeqIGVTILLQADLVFA
SSEHHHHHHHHCCEEEE
3kd3A192201HE7.54468874.969481136.96228177.707496jmol
SeqEKVINLSKYV
SSEHHHHHHCCEE
3gg9A208220HE7.65241473.102285144.12882496.016874jmol
SeqKDALFEQSDVLSV
SSEHHHHHHHCCEEEE
4arcA220231HE9.27220374.336595122.06332581.674248jmol
SeqPDTFMGCTYLAV
SSEHHHHHHCCEEEE
3l82B272287HE7.96083380.000598128.03527281.467745jmol
SeqIQKVCEVVDGFIYVAN
SSEHHHHHHHCCEEEEEEE
2iw3A587601HE9.13073087.044834129.48009451.336105jmol
SeqSVFLDNVCEYIINYE
SSEHHHHHHHCCEEEEEE
3rhbA220HE7.43068274.402141141.13306476.682183jmol
SeqRMEESIRKTVTENTVVIYS
SSEHHHHHHHHHHHHCCEEEEE
4ou6A3553HE9.18597083.578000130.12120897.520685jmol
SeqTEELASFIAYWQAEGKVFH
SSEHHHHHHHHHHHHHHCCEEE
3mgkA8199HE7.55543375.218246138.30095294.123430jmol
SeqDNFINFIGNMVKESKYIIS
SSEHHHHHHHHHHHHHCCEEEE
5bpdA131153HE8.30683765.629251146.386969109.272599jmol
SeqIKNSTLKTKEMLEEAQNEILLAD
SSEHHHHHHHHHHHHHHCCCEEEEEE
3nvwC647664HE7.98408572.166202130.387593109.545851jmol
SeqLKKGFSEADNVVSGELYI
SSEHHHHHHHCCEEEEEEEEE
1wcv1121138HE7.84696163.972856133.67830688.656785jmol
SeqPLTLNALAAAEGVVVPVQ
SSEHHHHHHHHHCCEEEEEEE
1f6bA6379HE9.10280282.936768137.770083102.717852jmol
SeqVWKNYLPAINGIVFLVD
SSEHHHHHHHHCCEEEEEEE
3bwvA6077HE7.99775666.457147140.25092370.277883jmol
SeqAQEVVKQLNEHYDIYIAT
SSEHHHHHHHHCCCCEEEEEE
1o6dA107118HE7.81614875.032760126.21608970.993541jmol
SeqEEIFAKAHRVFS
SSEHHHHHHCCEEEE
4i2uA220HE7.62499673.422090149.70577185.534817jmol
SeqAAKQLVDSTISGNKVVIFS
SSEHHHHHHHHHHHHCCEEEEE
4l2iA308318HE7.52816477.759511147.927330110.949562jmol
SeqPMFEISKYGIV
SSEHHHHHCCEEEE
3vx6A180192HE7.58175884.891292122.47761781.637312jmol
SeqPDNLKVCEKVVFK
SSEHHHHHHCCEEEEE
3tcrA7990HE7.54878068.736439129.66783985.822016jmol
SeqAPEATQPLLDRE
SSEHHHHHHHHCCEE
1rttA5573HE7.58206766.762556127.89986479.336228jmol
SeqPAVERFREQIRAADALLFA
SSEHHHHHHHHHHHHCCEEEEE
5agrA2031HE9.35246374.323459122.06283184.242289jmol
SeqPDTLFGATYLVL
SSEHHHHHHCCEEEE
2gmwA160170HE7.78982076.798287123.59493561.190174jmol
SeqPEAENAADWVL
SSEHHHHHHCCEEE
4qqrA168178HE7.66322968.699215144.127760108.227743jmol
SeqFITKIARYEKV
SSEHHHHHHHCCEE
3ea0A130144HE8.40989683.619852132.72851582.268482jmol
SeqGVWVLEHLDELCIVT
SSEHHHHHHHCCEEEEEE
3jqqA216234HE8.27964382.354349127.823732100.374845jmol
SeqKTEFLNLFNNYKCELYICG
SSEHHHHHHHHHHCCCEEEEEE
4finA481494HE8.86908689.179006139.96924068.319464jmol
SeqRWFLDRIATHILDY
SSEHHHHHHHCCEEEEE
4y9iA5165HE7.76130387.278052131.102612102.657687jmol
SeqWYFNVKANPTVSVQD
SSEHHHHHHHCCEEEEEE
3ss7X344358HE9.27011688.258404120.55881490.989503jmol
SeqVGRAMERLLDGFYTL
SSEHHHHHHHHCCEEEEE
3al2A162173HE8.52246788.031918131.30398571.414131jmol
SeqVPLFKEATHLFS
SSEHHHHHHCCEEEE
4nwbA1535HE7.74872685.618641132.78202687.852164jmol
SeqLFSNIRETIPKYQHCFVFSVD
SSEHHHHHHHHHHHCCEEEEEEEE
4ivnA100119HE7.52483263.011004122.627787104.583228jmol
SeqRKSLARIVERVHQAEFIGCI
SSEHHHHHHHHHHHHHCCEEEEE
3u62A3958HE7.93503587.982667145.72255069.178271jmol
SeqPESFDTEIRRILEEYDGFNA
SSEHHHHHHHHHHHHHHCCEEEE
2jdiD17661781HE7.78364569.110709143.56439395.723285jmol
SeqPAPATTFAHLDATTVL
SSEHHHHHHHHHCCEEEEE
3gwqA370383HE8.49426783.806098136.44348659.659165jmol
SeqPCLTFDKWRQVLVV
SSEHHHHHHHCCEEEEE
4yqdA123135HE8.88092088.279774122.72917060.026773jmol
SeqERLIQTEIDEEWS
SSEHHHHHHHCCEEEE
1fl2A3644HE8.26549566.043278121.90243071.821253jmol
SeqGQILDTVDI
SSEHHHHHCCEE
5ck4A5171HE9.25856579.685830134.84806276.829518jmol
SeqPKLRGTTLQHLLNPSPSLTII
SSEHHHHHHHHHHHHCCCCEEEEE
1dxyA191203HE7.96907978.452328144.05567788.586912jmol
SeqLEDLFKQSDVIDL
SSEHHHHHHHCCEEEE
1i7dA87109HE8.10779776.530824141.36175392.886118jmol
SeqPSVTKQLNVIKRFLHEASEIVHA
SSEHHHHHHHHHHHHHHHHCCEEEEE
1m65A8698HE8.21619676.909696125.10713559.451187jmol
SeqGKMFDSLDLIIAG
SSEHHHHHHCCEEEEE
4nf1A101113HE7.79043384.861915140.52257690.949450jmol
SeqNAFYYAESDGYYK
SSEHHHHHHHCCEEEE
1mv8A384396HE8.07127581.615627146.32442170.866568jmol
SeqLDEVVASSDVLVL
SSEHHHHHHHCCEEEE
4finA209222HE8.65691183.401913138.05582389.177133jmol
SeqRYFLDNVAGWILEL
SSEHHHHHHCCCEEEEE
4njmA176188HE7.91295083.277537145.40069667.252365jmol
SeqIEELFEECQVISL
SSEHHHHHHHCCEEEE
3bvpA85105HE8.54422363.121083141.59669098.862769jmol
SeqVRDTLYLVKDVFTKNKIDFIS
SSEHHHHHHHHHHCCCCCCCEEEE
4hl6A7593HE7.83400380.729018130.802840100.155770jmol
SeqDHDKSIFINMLKQADVLAE
SSEHHHHHHHHHHHHHCCEEEE
3o8qA6575HE7.50775465.565391131.30542299.204540jmol
SeqKEEAYRFADRL
SSEHHHHHHHCCEE
3ctzA294308HE8.43699770.371744140.76055370.235608jmol
SeqYAVSETIPKDHRCCM
SSEHHHHHHCCCCCEEEE
4e57A662674HE8.75354270.382873123.22508998.137082jmol
SeqREQVEAAVQERTP
SSEHHHHHHHCCEEEE
3g79A93104HE7.82447280.282427142.56336191.693821jmol